Dataset for protein Unclassified of organism Anabas testudineus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3Q1HMF6_uncBMF-01 Putative Bcl2 modifying factor protein OS=[Eukaryota] Anabas testudineus (length=142 residues).
MDDEEEDMSRPISQHWGTPFRDVKYEDLPTQISAGQALAGITARQPHIPFHGKKGLHVEPARHREDDDRMAQRPEDQAGV
SVEVQIGRKLREIGDKFQQDHLELFVRHQRQNLPIWMRLTMALFGFLFPREALIPRLRGEQR
© 1998-2019