Dataset for protein classical BH3-containing proteins of organism Anabas testudineus

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A3Q1ICY2_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Anabas testudineus GN=BCL2L11 (length=241 residues).
MDPRQPNRSDGSTAVTATGESGGDPPPVGAAGVSTPTSRSNDGGERRFGRPDSSGGGEPESQSRCRTKSSSSSDGLGVFR
SVFRLPRRSSSGYFSYDSDSQPSSPLSPRPVTFDRATQTPSPTGQVMNHALQRLAEANGSDLRTHQQHGSDLSSSSTQQQ
NAAGDMQAVEVGRELRRIGDDFNNHLLEVAGRHRWVGIQPIRLPHIHQDPTVLLCVGLLLFVIGRIIYSQGSTNSEGHSH
V
>gnl|bcl2dbpro|A0A3Q1IPR4_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Anabas testudineus GN=BMF (length=163 residues).
MDDEEDDVFEPDPHCWRTTFREIKCQDRGTQTPGPALPQNNGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELVGDLEVRQ
QDSEEEQNGMEIPPRQQPLMQSVEACIGQKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLAAAMLSLLFDRGLIAGGGGA
GRR
>gnl|bcl2dbpro|A0A3Q1K1C7_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Anabas testudineus GN=BAD (length=165 residues).
MAARFTISDSDSDPSEGMEEEGHNQSPPGQEQQVFPRHTLTLPELRASGRIRLNSESHASTVYRDEELQAKADEEAGTPT
DGAPFRARSKSAPPALWAAKKYGQQLRRMSDEFDSLLDKGEMRKVRSAGTARQMHHSKSWWSYLFSHQETEGENNHHESH
THRTE
>gnl|bcl2dbpro|A0A3Q1K1C7_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Anabas testudineus GN=BAD (length=165 residues).
MAARFTISDSDSDPSEGMEEEGHNQSPPGQEQQVFPRHTLTLPELRASGRIRLNSESHASTVYRDEELQAKADEEAGTPT
DGAPFRARSKSAPPALWAAKKYGQQLRRMSDEFDSLLDKGEMRKVRSAGTARQMHHSKSWWSYLFSHQETEGENNHHESH
THRTE
© 1998-2019