Dataset for protein Bim of organism Anabas testudineus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3Q1ICY2_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Anabas testudineus GN=BCL2L11 (length=241 residues).
MDPRQPNRSDGSTAVTATGESGGDPPPVGAAGVSTPTSRSNDGGERRFGRPDSSGGGEPESQSRCRTKSSSSSDGLGVFR
SVFRLPRRSSSGYFSYDSDSQPSSPLSPRPVTFDRATQTPSPTGQVMNHALQRLAEANGSDLRTHQQHGSDLSSSSTQQQ
NAAGDMQAVEVGRELRRIGDDFNNHLLEVAGRHRWVGIQPIRLPHIHQDPTVLLCVGLLLFVIGRIIYSQGSTNSEGHSH
V
© 1998-2019