Dataset for protein Bad of organism Anabas testudineus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3Q1K1C7_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Anabas testudineus GN=BAD (length=165 residues).
MAARFTISDSDSDPSEGMEEEGHNQSPPGQEQQVFPRHTLTLPELRASGRIRLNSESHASTVYRDEELQAKADEEAGTPT
DGAPFRARSKSAPPALWAAKKYGQQLRRMSDEFDSLLDKGEMRKVRSAGTARQMHHSKSWWSYLFSHQETEGENNHHESH
THRTE
>gnl|bcl2dbpro|A0A3Q1K1C7_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Anabas testudineus GN=BAD (length=165 residues).
MAARFTISDSDSDPSEGMEEEGHNQSPPGQEQQVFPRHTLTLPELRASGRIRLNSESHASTVYRDEELQAKADEEAGTPT
DGAPFRARSKSAPPALWAAKKYGQQLRRMSDEFDSLLDKGEMRKVRSAGTARQMHHSKSWWSYLFSHQETEGENNHHESH
THRTE
© 1998-2019