Dataset for protein Unclassified of organism Amphiprion percula

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3P8RSQ3_uncBMF-01 Putative Bcl2 modifying factor protein OS=[Eukaryota] Amphiprion percula (length=171 residues).
MDDEEEDMSRPISQPRGTSFGDVKFEDRATQIAAGQALAAVTAAVSTSQSHNNNSINALPCGLHRQPHIPFHGNAGLRSH
FPAQFEPMEDRGEREVEEEEEEGRGEDNDRMAERPEEQAGVSVEAQIGRKLREIGDKFHQDHVELVSLTAELWTRSTINC
PLQTPHSRAQS
© 1998-2019