Dataset for protein classical BH3-containing proteins of organism Amphiprion percula

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A3P8RKY9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Amphiprion percula GN=BMF (length=163 residues).
MDDEEDDVFEPDPHCWRTTFREIKCEDRGTQTPGPALQPNNGMLPCGVAEEPRPLFYGNAGFRLHFPARFELIGNHQARQ
QGSEMEQNGMEQLPRQQPVARSMEACIGQKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLAAAVLSLLFDRGFIAGGGGA
GRR
>gnl|bcl2dbpro|A0A3P8RLE2_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Amphiprion percula GN=BCL2L11 (length=197 residues).
ANRTPSLVGPEQKKRNGGNLRGGGADPEPVGAAGVSAKTSRLNSTGGEPDSPSWSRAQASLGVFQTRSIFHLPRRSSSGY
FSADGADSVPSSPLSPKRLTADKATQTPSPSGQVIKHALERMTDEAHGGGPGTQQHGELRLTYTREISCTFNLCNSFCTL
FSVTVFCHLQSLFASTLQNVLIRFINPNYFSTFWKRC
>gnl|bcl2dbpro|A0A3P8TWH6_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Amphiprion percula GN=BAD (length=167 residues).
MAAKFTISDSESEPSEEVEEGENNHSPATQAMPVFARRNMALPELRTPASGRLRLNSESHASTLSRDEELQARGEEEAGT
PTDGAPFRARSKSAPPALWAAKKYGQQLRRMSDEFDSLLDKGEMKRVRSAGTARQMHHSKSWWSYLFSHQEMEGENNHHE
SHTHRNE
© 1998-2019