Dataset for protein Bmf of organism Amphiprion percula

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3P8RKY9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Amphiprion percula GN=BMF (length=163 residues).
MDDEEDDVFEPDPHCWRTTFREIKCEDRGTQTPGPALQPNNGMLPCGVAEEPRPLFYGNAGFRLHFPARFELIGNHQARQ
QGSEMEQNGMEQLPRQQPVARSMEACIGQKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLAAAVLSLLFDRGFIAGGGGA
GRR
© 1998-2019