Dataset for protein Bim of organism Amphiprion percula

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3P8RLE2_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Amphiprion percula GN=BCL2L11 (length=197 residues).
ANRTPSLVGPEQKKRNGGNLRGGGADPEPVGAAGVSAKTSRLNSTGGEPDSPSWSRAQASLGVFQTRSIFHLPRRSSSGY
FSADGADSVPSSPLSPKRLTADKATQTPSPSGQVIKHALERMTDEAHGGGPGTQQHGELRLTYTREISCTFNLCNSFCTL
FSVTVFCHLQSLFASTLQNVLIRFINPNYFSTFWKRC
© 1998-2019