Dataset for protein Bad of organism Amphiprion percula

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3P8TWH6_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Amphiprion percula GN=BAD (length=167 residues).
MAAKFTISDSESEPSEEVEEGENNHSPATQAMPVFARRNMALPELRTPASGRLRLNSESHASTLSRDEELQARGEEEAGT
PTDGAPFRARSKSAPPALWAAKKYGQQLRRMSDEFDSLLDKGEMKRVRSAGTARQMHHSKSWWSYLFSHQEMEGENNHHE
SHTHRNE
© 1998-2019