Dataset for protein classical BH3-containing proteins of organism Amphiprion ocellaris

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A3Q1CI15_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Amphiprion ocellaris GN=BCL2L11 (length=182 residues).
PTKSGPDAAARCFTSGSRCRDSERLPPNPSHGSPDSPSWSRAQASLGVFQTRSIFHLPRRSSSGYFSADGADSVPSSPLS
PKRLTADKATQTPSPSGQVIKHALERMTDEAHGGGPGTQQHGELRLTYTREISCTFNLCNSFCTLFSVTVFCHLQSLFAS
TLQNVLIRFINPNYFSTFWNRC
>gnl|bcl2dbpro|A0A3Q1CPU7_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Amphiprion ocellaris GN=BAD (length=167 residues).
MAAKFTISDSESEPSEEVEEGENNHSPATQAMPVFARRNMALPELRTPASGRLRLNSESHASTLSRDEELQARGEEEAGT
PTDGAPFRARSKSAPPALWAAKKYGQQLRRMSDEFDSLLDKGEMKRVRSAGTARQMHHSKSWWSYLFSHQEMEGENNHHE
SHTHRNE
>gnl|bcl2dbpro|A0A3Q1D1K3_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Amphiprion ocellaris GN=BMF (length=163 residues).
MDDEEDDVFEPDPHCWRTTFREIKCEDRGTQTPGPALQPNNGMLPCGVAEEPRPLFYGNAGFRLHFPARFELIGNHQARQ
QGSEMEQNGMEQLPRQQPVARSMEACIGQKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLAAAVLSLLFDRGFIAGGGGA
GRR
© 1998-2019