Dataset for protein Bim of organism Amphiprion ocellaris

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3Q1CI15_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Amphiprion ocellaris GN=BCL2L11 (length=182 residues).
PTKSGPDAAARCFTSGSRCRDSERLPPNPSHGSPDSPSWSRAQASLGVFQTRSIFHLPRRSSSGYFSADGADSVPSSPLS
PKRLTADKATQTPSPSGQVIKHALERMTDEAHGGGPGTQQHGELRLTYTREISCTFNLCNSFCTLFSVTVFCHLQSLFAS
TLQNVLIRFINPNYFSTFWNRC
© 1998-2019