Dataset for protein Bad of organism Amphiprion ocellaris

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3Q1CPU7_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Amphiprion ocellaris GN=BAD (length=167 residues).
MAAKFTISDSESEPSEEVEEGENNHSPATQAMPVFARRNMALPELRTPASGRLRLNSESHASTLSRDEELQARGEEEAGT
PTDGAPFRARSKSAPPALWAAKKYGQQLRRMSDEFDSLLDKGEMKRVRSAGTARQMHHSKSWWSYLFSHQEMEGENNHHE
SHTHRNE
© 1998-2019