Dataset for protein Unclassified of organism Amphilophus citrinellus

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|A0A3Q0RUR2_uncBCL2L11-01 Putative BCL2-like 11 protein OS=[Eukaryota] Amphilophus citrinellus (length=178 residues).
LARPPKPSDGPTAVTASEDSGGDPPPVCATGAQTSRLNRESTGGGEPDSPSWARTPTSFAAYQSRTIFRFPRRSSSGYFS
MECDSMPSSPLSPKPMMADKAIQTPSLSSQVLTHALQRMGEVRDEGPETNQQQGEHRQMCVFVYYDTQCRNLSVNLKKES
SASPNGFQVYILGSIFIS
>gnl|bcl2dbpro|A0A3Q0SC56_uncBMF-01 Putative Bcl2 modifying factor protein OS=[Eukaryota] Amphilophus citrinellus (length=140 residues).
MDDEEDDVFKPKARCWHTTFRQIKCEHRGTQTPGPALVPNNGMLPCFRLHFPARFELVGDHEARQQESEEQPNRMERLPR
QRPVARGVEACIGQKLQLIGDQFHRERLQLGPLWWRLAAALLSLLFDRGFFAGGGGAGRR
© 1998-2019