Dataset for protein Bad of organism Amphilophus citrinellus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3Q0QNQ2_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Amphilophus citrinellus GN=BAD (length=162 residues).
FIHFLPFIQGRGQQPSHLLQLIWGTPRHSQAIGHDQNTSPMRHPTARRIRMNSESHTSSVSRDEELVVRGEDEICTPTEG
DPFRRRSKSAPPALWAAKKYGQQLRRMSDEFDSLLDKGMKKAKNAGTTRKMHHSKTWWSYLFSHQESDGENSHHENHTQR
TE
>gnl|bcl2dbpro|A0A3Q0QNQ2_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Amphilophus citrinellus GN=BAD (length=143 residues).
MPEPPRLVLFDVEEGQSPFREGSFLLLVSVISFFWSLPKAFSRDEELVVRGEDEICTPTEGDPFRRRSKSAPPALWAAKK
YGQQLRRMSDEFDSLLDKGMKKAKNAGTTRKMHHSKTWWSYLFSHQESDGENSHHENHTQRTE
© 1998-2019