Dataset for protein classical BH3-containing proteins of organism Ailuropoda melanoleuca

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|G1LDR8_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BCL2L11 (length=196 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAY
YPRRVFLNNYQAAEAHPQMIILRLLRYIVRLVWRLQ
>gnl|bcl2dbpro|G1LIZ7_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Ailuropoda melanoleuca GN=PMAIP1 (length=54 residues).
MPGKKARKSAQASPARTRGQPEVECAIQLRRFGDKLNFRQKLLNLISKLFRSGT
>gnl|bcl2dbpro|G1MI17_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Ailuropoda melanoleuca GN=BAD (length=210 residues).
VGTPENPSSAPTHGPGKRKSGTDRRETRKGPRTTALAPTAQSMFQIPEFEPSEQEDSSPADRGLGPSPTGDQPPGPGKHR
QTAPGLLGEAAHPQGQPASSNHHGGAGAVEPRSRHSSYPAGTEEDEGLEEEELSPFRGRSSSAPPNLCAALRYGRELRRM
SDEFQGSFKGLPRPKSAGTATQMRQSPSWTRVIQSWWDRNLGRGGSAPSQ
© 1998-2018