Dataset for protein Unclassified of organism Acanthochromis polyacanthus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3Q1G016_uncBMF-01 Putative Bcl2 modifying factor protein OS=[Eukaryota] Acanthochromis polyacanthus (length=173 residues).
MDDEEEDMSRPISQLWGTSFGDVKFEDRATQITAGQAFASHDNNSINALPCGLHRQPHIPFHGNAGLRSHFPAQFEPMED
RGEREVEEEEEEGRGEDNERMAERPEEQAGVSVEAQIGRKLREIGDKFHQDHVELFMRHQRQNLPVWMRLTMALFGFLFP
REAHVPRLRGAQR
© 1998-2019