Dataset for protein classical BH3-containing proteins of organism Acanthochromis polyacanthus

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A3Q1ELG4_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Acanthochromis polyacanthus GN=BCL2L11 (length=180 residues).
SSSAASPAAPHADTTEGGGADPEPVGAAGVSAKTSRSNSTGGEPDSPSWSRASLGVFQTRSIFHLPRRSSSGYFSADGSD
SVPSSPLSPKRLTADKTTQTPSPSGQVIRHALERMAGEAHRGGPETQRQQHGELNDCRSCGQRKTSLTFSAVVFALAIVC
PCLLSFLFTVCFRFCNKRVK
>gnl|bcl2dbpro|A0A3Q1FVH7_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Acanthochromis polyacanthus GN=BMF (length=159 residues).
MDDEEDDVFEPDTHCWRTTFREIKCEDRGTQTPGPALQPNNGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELIARQQGSE
MEQNGMEQLPRQQPMAHSVEACIGQKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLVAAILSLLFDGGFIAGGGGAGRR
>gnl|bcl2dbpro|A0A3Q1FVH7_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Acanthochromis polyacanthus GN=BMF (length=159 residues).
MDDEEDDVFEPDTHCWRTTFREIKCEDRGTQTPGPALQPNNGMLPCGVAEEPRPLFYGNAGFRLHFPAHFELIARQQGSE
MEQNGMEQLPRQQPMAHSVEACIGQKLQLIGDQFHREHLQLYHRNQRNQGPLWWRLVAAILSLLFDGGFIAGGGGAGRR
>gnl|bcl2dbpro|A0A3Q1GWH9_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Acanthochromis polyacanthus GN=BAD (length=165 residues).
MAAKFSISDGDSEPEEVEGENNHSPATEAMPVFARRNMALPELRTPASGRIRLNSESHASTLSRDEELQAKGEEEAGTPT
EGAPFRARSKSAPPALWAAKKYGQQLRRMSDEFDSLLDKGEMKRVRSAGTARQMHHSKSWWSYLFSHQEMEGENNHHESH
THRNE
© 1998-2019