Dataset for protein Bim of organism Acanthochromis polyacanthus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3Q1ELG4_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Acanthochromis polyacanthus GN=BCL2L11 (length=180 residues).
SSSAASPAAPHADTTEGGGADPEPVGAAGVSAKTSRSNSTGGEPDSPSWSRASLGVFQTRSIFHLPRRSSSGYFSADGSD
SVPSSPLSPKRLTADKTTQTPSPSGQVIRHALERMAGEAHRGGPETQRQQHGELNDCRSCGQRKTSLTFSAVVFALAIVC
PCLLSFLFTVCFRFCNKRVK
© 1998-2019