Dataset for protein Bad of organism Acanthochromis polyacanthus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A3Q1GWH9_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Acanthochromis polyacanthus GN=BAD (length=165 residues).
MAAKFSISDGDSEPEEVEGENNHSPATEAMPVFARRNMALPELRTPASGRIRLNSESHASTLSRDEELQAKGEEEAGTPT
EGAPFRARSKSAPPALWAAKKYGQQLRRMSDEFDSLLDKGEMKRVRSAGTARQMHHSKSWWSYLFSHQEMEGENNHHESH
THRNE
© 1998-2019