Dataset for protein poxviridae of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

19 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q70HB1_FPV039-01        -----MASSNMKDETYYIALNMIQNY---IIEYNTNKPRKSFVIDSISYD
Q9J5G4_FPV039-01        -----MASSNMKDETYYIALNMIQNY---IIEYNTNKPRKSFVIDSISYD
Q6TV64_ORFV125-01       MIGDRHRDDTDIDASAVVTAYLASEYANAVIDNLSDAERVALEALRASGD
D3IZD7_ORFV125-01       -----MANRNEIDSSAVVAAYLAGQYAAAVEEQLTPREREALEALRISGD
D3IZF4_ORFV125-01       -----MANRNDIDSSAVVAAYLAGQYAAAVEEQLTPREREALAALRISGD
Q6TVJ5_ORFV125-01       -----MANRDDIDASAVMAAYLAREYAEAVEEQLTLRERDALEALRVSGE
F1AXH8_ORFV125-01       -----MANREEIDASAVMAAYLAREYAVAVEEQLTPRERDALEALRVSGE
A0A0F6N236_ORFV125      -----MANREEIDASAVMAAYLAREYAAAVEEQLTPRERDALEALRVSGE
Q6TVX5_ORFV125-01       -----MANREEIDASAVMAAYLAREYAAAVEEQLTPRERDALEALRVSGE
Q80G30_ORFV125-01       -----MANREEIDASAVMAAYLAREYAAAVEEQLTPRERDALEALRVSGE
W6EVU4_ORFV125-01       -----MANREEIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGE
A0A2Z2QAK0_ORFV125      -----MANREEIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGE
A0A2Z2Q9B0_ORFV125      -----MANRDDIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGE
A0A1D8RAA0_ORFV125      -----MANREEIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGE
A0A0R8HLA0_ORFV125      -----MANRDDIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGE
A0A0R8HV90_ORFV125      -----MANRDDIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGE
A0A0R8I4U2_ORFV125      -----MANRDEIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGE
A0A2Z2Q5R8_ORFV125      -----MANRDDIDASAVMAAHLAREYAEAVEEQLTPRERDALEALRVSGE
A0A2Z2Q7G3_ORFV125      -----MANRDDIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGE
                               .    * :  ::  :  :*   : :  :   * ::     * :

Q70HB1_FPV039-01        VLKAACKSVIKTNYNEFDIIISRNIDFNVIVTQVLEDKINWGRIITIIAF
Q9J5G4_FPV039-01        VLKAACKSVIKTNYNEFDIIISRNIDFNVIVTQVLEDKINWGRIITIIAF
Q6TV64_ORFV125-01       EVRHPMLQEL-TNAGGNHANPETSHIPATLISALLEAPASPGRMVTAIEL
D3IZD7_ORFV125-01       EVRSPLLQEL-SNAGDYRANPESSHIPAALVSALLEAPTSPGRMVTAVEL
D3IZF4_ORFV125-01       EVRSPLLREL-SNAGDYRANPENSHIPAALVSALLEAPTSPGRMVTAVEL
Q6TVJ5_ORFV125-01       EVRSPLLQEL-SNAGEHRTNPENSHIPAALVSALLETPTSPGRMVTAVEL
F1AXH8_ORFV125-01       EVRSPLLQEL-SNAGEHRANPENSHIPAALVSALLEAPTSPGRMVTAIEL
A0A0F6N236_ORFV125      EVRSPLLQEL-SNAGEHRANPENSHIPAALVSALLEAPTSPGRMVTAIEL
Q6TVX5_ORFV125-01       EVRSPLLQEL-SNAGEHRANPENSHIPAALVSALLEAPTSPGRMVTAIEL
Q80G30_ORFV125-01       EVRSPLLQEL-SNAGEHRANPENSHIPAALVSALLEAPTSPGRMVTAIEL
W6EVU4_ORFV125-01       EVRSPLLQEL-SNAGEHRANPENSHIPAALVSALLEAPTSPGRMVTAVEL
A0A2Z2QAK0_ORFV125      EVRPPLLQEL-SNAGEHRANPENSHIPAALVSALLEAPTSPGRMVTAVEL
A0A2Z2Q9B0_ORFV125      EVRSPLLQEL-SNAGEHRANPENSHIPAALVSALLEAPTSPGRVVTAVGL
A0A1D8RAA0_ORFV125      EVRSPLLQEL-SNAGEHRANPENSHIPAALVSALLEAPTSPGRMVTAVEL
A0A0R8HLA0_ORFV125      EVRSPLLQEL-SNAGEHRANPENSHIPAALVSALLEAPTSPGRMVTAVEL
A0A0R8HV90_ORFV125      EVRSPLLQEL-SNAGEHRANPENSHIPAALVSALLEAPTSPGRMVTAVEL
A0A0R8I4U2_ORFV125      EVRSPLLQEL-SNAGEHRANPENSHIPAALVSALLEAPTSPGRMVTAVEL
A0A2Z2Q5R8_ORFV125      EVRSPLLQEL-SNAGEHRANPENSHIPAALVSALLEAPTSPGRMVTAVEL
A0A2Z2Q7G3_ORFV125      EVRSPLLQEL-SNAGEHRANPENSHIPAALVSALLEAPTSPGRMVTAVEL
                         :. .    : :* .      . .    .::: :**   . **::* : :

Q70HB1_FPV039-01        CAYYSKKVKQDTSPQYYDGIIS---EAITDAILSKYRSWFIDQDYWNGIR
Q9J5G4_FPV039-01        CAYYSKKVKQDTSPQYYDGIIS---EAITDAILSKYRSWFIDQDYWNGIR
Q6TV64_ORFV125-01       CAQMGRRWTRRFQFLNFMRLVHVLVDRMPPTASEDLAVWLERAARVQATR
D3IZD7_ORFV125-01       CAQMGRLWTRGRRLIDFVRLVHVLFDRMPSTANDDLAAWLQTVARVHRSR
D3IZF4_ORFV125-01       CAQMGRLWTRGRRLIDFMRLVHVLFDRMPSTANDDLAAWLQTVARVHRSR
Q6TVJ5_ORFV125-01       CAQMGRLWTRGRQLVDFMRLVYVLLDRLPPTADEDLGAWLQAVARVHGTR
F1AXH8_ORFV125-01       CAQMGRLWTRGHKLVDFMRLVYVLLNRLPPTADEDLSAWLQAVARVHGTR
A0A0F6N236_ORFV125      CAQMGRVWTRGRKLVDFMRLVYVLLDRLPPTADEDLSAWLQAVARVHGTR
Q6TVX5_ORFV125-01       CAQMGRVWTRGRRLVDFMRLVYVLLDRLPPTADEDLSAWLQAVARVHGTR
Q80G30_ORFV125-01       CAQMGRVWTRGRQLVEFMRLVYVLLDRLPPTADEDLSTWLQAVARVHGTR
W6EVU4_ORFV125-01       CAQMGRLWTRGRQLVDFMRLVYVLLDRLPPTADEDLSAWLQAVARVHGTR
A0A2Z2QAK0_ORFV125      CAQMGRLWTRGRQLVDFMRLVYVLLDRLPPTADEDLGAWLQAVARVHGTR
A0A2Z2Q9B0_ORFV125      CAQMGRLWTRGRQLVDFMRLVYVLLDRLPPTADEDLGAWLQAVARVHGTR
A0A1D8RAA0_ORFV125      CAQMGRLWTRGRQLVDFMRLVYVLLDRLPPTADEDLGAWLQAVARVHGTR
A0A0R8HLA0_ORFV125      CAQMGRLWTRGRRLVDFMRLVYVLLDRLPPTADEDLGAWLQAVARVHGTR
A0A0R8HV90_ORFV125      CAQMGRLWTRGRQLVDFMRLVYVLLDRLPPTADEDLGAWLQAVARVHGTR
A0A0R8I4U2_ORFV125      CAQMGRLWTRGRQLVDFMRLVYVLLDRLPPTADEDLGAWLQAVARVHGTR
A0A2Z2Q5R8_ORFV125      CAQMGRLWTRGRQLVDFMRLVYVLLDRLPPTADEDLGAWLQAVARVHGTR
A0A2Z2Q7G3_ORFV125      CAQMGRLWTRGRQLVDFMRLVYVLLDRLPPTADEDLGAWLQAVARVHGTR
                        **  ..  ..      :  ::    : :. :  ..   *:      :  *

Q70HB1_FPV039-01        IYKNYSYIFNTASYCIFTASLIIASLAVFKICSFYM
Q9J5G4_FPV039-01        IYKNYSYIFNTASYCIFTASLIIASLAVFKICSFYM
Q6TV64_ORFV125-01       --HRMSRVAGLGMFLAGCGILFVGARFLRR------
D3IZD7_ORFV125-01       --RWLHRSIGVGTVMAGVGLLFLGVRVLRRT-----
D3IZF4_ORFV125-01       --RWLHRSIGVGTVMAGVGLLFLGVRVLRRT-----
Q6TVJ5_ORFV125-01       --RRLHRALGVGAVVAGVGMLLLGVRVLRRT-----
F1AXH8_ORFV125-01       --RRLHRVLGVGAVVAGVGMLLLGVRVLRRT-----
A0A0F6N236_ORFV125      --RRLHRVLGVGAVMAGVGMLLLGVRVLRRT-----
Q6TVX5_ORFV125-01       --RRLHRVLGVGAVMAGVGMLLLGVRVLRRT-----
Q80G30_ORFV125-01       --RRLHRVLGVGAVMAGVGMLLLGVRVLRRT-----
W6EVU4_ORFV125-01       --RRLHRVLGVGAVMAGVGMLLLGVRVLRRT-----
A0A2Z2QAK0_ORFV125      --RRLHRALGVGAVVAGVGMLLLGVRVLRRT-----
A0A2Z2Q9B0_ORFV125      --RRLHRALGVGAVVAGVGMLLLGVRVLRRT-----
A0A1D8RAA0_ORFV125      --RRLHRALGVGAVVAGVGMLLLGVRVLRRT-----
A0A0R8HLA0_ORFV125      --RRLHRALGVGAVVAGVGMLLLGVRVLRRT-----
A0A0R8HV90_ORFV125      --RRLHRALGVGAVVAGVGMLLLGVRVLRRT-----
A0A0R8I4U2_ORFV125      --RRLHRALGVGAVVAGVGMLLLGVRVLRRT-----
A0A2Z2Q5R8_ORFV125      --RRLHRALGVGAVVAGVGMLLLGVRVLRRT-----
A0A2Z2Q7G3_ORFV125      --RRLHRTLGVGAVVAGVGMLLLGVRVLRRT-----
                          ..     . .      . *::.   : .      

© 1998-2018