Dataset for protein ORFV125 of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

13 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q6TV64_ORFV125-01       MIGDRHRDDTDIDASAVVTAYLASEYANAVIDNLSDAERVALEALRASGD
D3IZD7_ORFV125-01       -----MANRNEIDSSAVVAAYLAGQYAAAVEEQLTPREREALEALRISGD
D3IZF4_ORFV125-01       -----MANRNDIDSSAVVAAYLAGQYAAAVEEQLTPREREALAALRISGD
Q6TVJ5_ORFV125-01       -----MANRDDIDASAVMAAYLAREYAEAVEEQLTLRERDALEALRVSGE
F1AXH8_ORFV125-01       -----MANREEIDASAVMAAYLAREYAVAVEEQLTPRERDALEALRVSGE
A0A0F6N236_ORFV125      -----MANREEIDASAVMAAYLAREYAAAVEEQLTPRERDALEALRVSGE
Q6TVX5_ORFV125-01       -----MANREEIDASAVMAAYLAREYAAAVEEQLTPRERDALEALRVSGE
Q80G30_ORFV125-01       -----MANREEIDASAVMAAYLAREYAAAVEEQLTPRERDALEALRVSGE
W6EVU4_ORFV125-01       -----MANREEIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGE
A0A1D8RAA0_ORFV125      -----MANREEIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGE
A0A0R8HLA0_ORFV125      -----MANRDDIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGE
A0A0R8HV90_ORFV125      -----MANRDDIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGE
A0A0R8I4U2_ORFV125      -----MANRDEIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGE
                               :  :**:***::**** :** ** ::*:  ** ** *** **:

Q6TV64_ORFV125-01       EVRHPMLQELTNAGGNHANPETSHIPATLISALLEAPASPGRMVTAIELC
D3IZD7_ORFV125-01       EVRSPLLQELSNAGDYRANPESSHIPAALVSALLEAPTSPGRMVTAVELC
D3IZF4_ORFV125-01       EVRSPLLRELSNAGDYRANPENSHIPAALVSALLEAPTSPGRMVTAVELC
Q6TVJ5_ORFV125-01       EVRSPLLQELSNAGEHRTNPENSHIPAALVSALLETPTSPGRMVTAVELC
F1AXH8_ORFV125-01       EVRSPLLQELSNAGEHRANPENSHIPAALVSALLEAPTSPGRMVTAIELC
A0A0F6N236_ORFV125      EVRSPLLQELSNAGEHRANPENSHIPAALVSALLEAPTSPGRMVTAIELC
Q6TVX5_ORFV125-01       EVRSPLLQELSNAGEHRANPENSHIPAALVSALLEAPTSPGRMVTAIELC
Q80G30_ORFV125-01       EVRSPLLQELSNAGEHRANPENSHIPAALVSALLEAPTSPGRMVTAIELC
W6EVU4_ORFV125-01       EVRSPLLQELSNAGEHRANPENSHIPAALVSALLEAPTSPGRMVTAVELC
A0A1D8RAA0_ORFV125      EVRSPLLQELSNAGEHRANPENSHIPAALVSALLEAPTSPGRMVTAVELC
A0A0R8HLA0_ORFV125      EVRSPLLQELSNAGEHRANPENSHIPAALVSALLEAPTSPGRMVTAVELC
A0A0R8HV90_ORFV125      EVRSPLLQELSNAGEHRANPENSHIPAALVSALLEAPTSPGRMVTAVELC
A0A0R8I4U2_ORFV125      EVRSPLLQELSNAGEHRANPENSHIPAALVSALLEAPTSPGRMVTAVELC
                        *** *:*.**:***  .:***.*****:*:*****:*:********:***

Q6TV64_ORFV125-01       AQMGRRWTRRFQFLNFMRLVHVLVDRMPPTASEDLAVWLERAARVQATRH
D3IZD7_ORFV125-01       AQMGRLWTRGRRLIDFVRLVHVLFDRMPSTANDDLAAWLQTVARVHRSRR
D3IZF4_ORFV125-01       AQMGRLWTRGRRLIDFMRLVHVLFDRMPSTANDDLAAWLQTVARVHRSRR
Q6TVJ5_ORFV125-01       AQMGRLWTRGRQLVDFMRLVYVLLDRLPPTADEDLGAWLQAVARVHGTRR
F1AXH8_ORFV125-01       AQMGRLWTRGHKLVDFMRLVYVLLNRLPPTADEDLSAWLQAVARVHGTRR
A0A0F6N236_ORFV125      AQMGRVWTRGRKLVDFMRLVYVLLDRLPPTADEDLSAWLQAVARVHGTRR
Q6TVX5_ORFV125-01       AQMGRVWTRGRRLVDFMRLVYVLLDRLPPTADEDLSAWLQAVARVHGTRR
Q80G30_ORFV125-01       AQMGRVWTRGRQLVEFMRLVYVLLDRLPPTADEDLSTWLQAVARVHGTRR
W6EVU4_ORFV125-01       AQMGRLWTRGRQLVDFMRLVYVLLDRLPPTADEDLSAWLQAVARVHGTRR
A0A1D8RAA0_ORFV125      AQMGRLWTRGRQLVDFMRLVYVLLDRLPPTADEDLGAWLQAVARVHGTRR
A0A0R8HLA0_ORFV125      AQMGRLWTRGRRLVDFMRLVYVLLDRLPPTADEDLGAWLQAVARVHGTRR
A0A0R8HV90_ORFV125      AQMGRLWTRGRQLVDFMRLVYVLLDRLPPTADEDLGAWLQAVARVHGTRR
A0A0R8I4U2_ORFV125      AQMGRLWTRGRQLVDFMRLVYVLLDRLPPTADEDLGAWLQAVARVHGTRR
                        ***** ***  .:::*:***:**.:*:*.**.:**..**: .***: :*.

Q6TV64_ORFV125-01       RMSRVAGLGMFLAGCGILFVGARFLRR-
D3IZD7_ORFV125-01       WLHRSIGVGTVMAGVGLLFLGVRVLRRT
D3IZF4_ORFV125-01       WLHRSIGVGTVMAGVGLLFLGVRVLRRT
Q6TVJ5_ORFV125-01       RLHRALGVGAVVAGVGMLLLGVRVLRRT
F1AXH8_ORFV125-01       RLHRVLGVGAVVAGVGMLLLGVRVLRRT
A0A0F6N236_ORFV125      RLHRVLGVGAVMAGVGMLLLGVRVLRRT
Q6TVX5_ORFV125-01       RLHRVLGVGAVMAGVGMLLLGVRVLRRT
Q80G30_ORFV125-01       RLHRVLGVGAVMAGVGMLLLGVRVLRRT
W6EVU4_ORFV125-01       RLHRVLGVGAVMAGVGMLLLGVRVLRRT
A0A1D8RAA0_ORFV125      RLHRALGVGAVVAGVGMLLLGVRVLRRT
A0A0R8HLA0_ORFV125      RLHRALGVGAVVAGVGMLLLGVRVLRRT
A0A0R8HV90_ORFV125      RLHRALGVGAVVAGVGMLLLGVRVLRRT
A0A0R8I4U2_ORFV125      RLHRALGVGAVVAGVGMLLLGVRVLRRT
                        .: *  *:* .:** *:*::*.*.*** 

© 1998-2018