Dataset for protein poxviridae of organism Pseudocowpox virus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


D3IZD7_ORFV125-01      MANRNEIDSSAVVAAYLAGQYAAAVEEQLTPREREALEALRISGDEVRSP
D3IZF4_ORFV125-01      MANRNDIDSSAVVAAYLAGQYAAAVEEQLTPREREALAALRISGDEVRSP
                       *****:******************************* ************

D3IZD7_ORFV125-01      LLQELSNAGDYRANPESSHIPAALVSALLEAPTSPGRMVTAVELCAQMGR
D3IZF4_ORFV125-01      LLRELSNAGDYRANPENSHIPAALVSALLEAPTSPGRMVTAVELCAQMGR
                       **.*************.*********************************

D3IZD7_ORFV125-01      LWTRGRRLIDFVRLVHVLFDRMPSTANDDLAAWLQTVARVHRSRRWLHRS
D3IZF4_ORFV125-01      LWTRGRRLIDFMRLVHVLFDRMPSTANDDLAAWLQTVARVHRSRRWLHRS
                       ***********:**************************************

D3IZD7_ORFV125-01      IGVGTVMAGVGLLFLGVRVLRRT
D3IZF4_ORFV125-01      IGVGTVMAGVGLLFLGVRVLRRT
                       ***********************

© 1998-2018