Dataset for protein ORFV125 of organism Orf virus

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q6TVJ5_ORFV125-01       MANRDDIDASAVMAAYLAREYAEAVEEQLTLRERDALEALRVSGEEVRSP
F1AXH8_ORFV125-01       MANREEIDASAVMAAYLAREYAVAVEEQLTPRERDALEALRVSGEEVRSP
A0A0F6N236_ORFV125      MANREEIDASAVMAAYLAREYAAAVEEQLTPRERDALEALRVSGEEVRSP
Q6TVX5_ORFV125-01       MANREEIDASAVMAAYLAREYAAAVEEQLTPRERDALEALRVSGEEVRSP
Q80G30_ORFV125-01       MANREEIDASAVMAAYLAREYAAAVEEQLTPRERDALEALRVSGEEVRSP
W6EVU4_ORFV125-01       MANREEIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGEEVRSP
A0A1D8RAA0_ORFV125      MANREEIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGEEVRSP
A0A0R8HLA0_ORFV125      MANRDDIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGEEVRSP
A0A0R8HV90_ORFV125      MANRDDIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGEEVRSP
A0A0R8I4U2_ORFV125      MANRDEIDASAVMAAYLAREYAEAVEEQLTPRERDALEALRVSGEEVRSP
                        ****::**************** ******* *******************

Q6TVJ5_ORFV125-01       LLQELSNAGEHRTNPENSHIPAALVSALLETPTSPGRMVTAVELCAQMGR
F1AXH8_ORFV125-01       LLQELSNAGEHRANPENSHIPAALVSALLEAPTSPGRMVTAIELCAQMGR
A0A0F6N236_ORFV125      LLQELSNAGEHRANPENSHIPAALVSALLEAPTSPGRMVTAIELCAQMGR
Q6TVX5_ORFV125-01       LLQELSNAGEHRANPENSHIPAALVSALLEAPTSPGRMVTAIELCAQMGR
Q80G30_ORFV125-01       LLQELSNAGEHRANPENSHIPAALVSALLEAPTSPGRMVTAIELCAQMGR
W6EVU4_ORFV125-01       LLQELSNAGEHRANPENSHIPAALVSALLEAPTSPGRMVTAVELCAQMGR
A0A1D8RAA0_ORFV125      LLQELSNAGEHRANPENSHIPAALVSALLEAPTSPGRMVTAVELCAQMGR
A0A0R8HLA0_ORFV125      LLQELSNAGEHRANPENSHIPAALVSALLEAPTSPGRMVTAVELCAQMGR
A0A0R8HV90_ORFV125      LLQELSNAGEHRANPENSHIPAALVSALLEAPTSPGRMVTAVELCAQMGR
A0A0R8I4U2_ORFV125      LLQELSNAGEHRANPENSHIPAALVSALLEAPTSPGRMVTAVELCAQMGR
                        ************:*****************:**********:********

Q6TVJ5_ORFV125-01       LWTRGRQLVDFMRLVYVLLDRLPPTADEDLGAWLQAVARVHGTRRRLHRA
F1AXH8_ORFV125-01       LWTRGHKLVDFMRLVYVLLNRLPPTADEDLSAWLQAVARVHGTRRRLHRV
A0A0F6N236_ORFV125      VWTRGRKLVDFMRLVYVLLDRLPPTADEDLSAWLQAVARVHGTRRRLHRV
Q6TVX5_ORFV125-01       VWTRGRRLVDFMRLVYVLLDRLPPTADEDLSAWLQAVARVHGTRRRLHRV
Q80G30_ORFV125-01       VWTRGRQLVEFMRLVYVLLDRLPPTADEDLSTWLQAVARVHGTRRRLHRV
W6EVU4_ORFV125-01       LWTRGRQLVDFMRLVYVLLDRLPPTADEDLSAWLQAVARVHGTRRRLHRV
A0A1D8RAA0_ORFV125      LWTRGRQLVDFMRLVYVLLDRLPPTADEDLGAWLQAVARVHGTRRRLHRA
A0A0R8HLA0_ORFV125      LWTRGRRLVDFMRLVYVLLDRLPPTADEDLGAWLQAVARVHGTRRRLHRA
A0A0R8HV90_ORFV125      LWTRGRQLVDFMRLVYVLLDRLPPTADEDLGAWLQAVARVHGTRRRLHRA
A0A0R8I4U2_ORFV125      LWTRGRQLVDFMRLVYVLLDRLPPTADEDLGAWLQAVARVHGTRRRLHRA
                        :****..**:*********:**********.:*****************.

Q6TVJ5_ORFV125-01       LGVGAVVAGVGMLLLGVRVLRRT
F1AXH8_ORFV125-01       LGVGAVVAGVGMLLLGVRVLRRT
A0A0F6N236_ORFV125      LGVGAVMAGVGMLLLGVRVLRRT
Q6TVX5_ORFV125-01       LGVGAVMAGVGMLLLGVRVLRRT
Q80G30_ORFV125-01       LGVGAVMAGVGMLLLGVRVLRRT
W6EVU4_ORFV125-01       LGVGAVMAGVGMLLLGVRVLRRT
A0A1D8RAA0_ORFV125      LGVGAVVAGVGMLLLGVRVLRRT
A0A0R8HLA0_ORFV125      LGVGAVVAGVGMLLLGVRVLRRT
A0A0R8HV90_ORFV125      LGVGAVVAGVGMLLLGVRVLRRT
A0A0R8I4U2_ORFV125      LGVGAVVAGVGMLLLGVRVLRRT
                        ******:****************

© 1998-2018