Dataset for protein FPV039 of organism Fowlpox virus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A385HA64_FPV039-      MASSNMKDETYYIALNMIQNYIIEYNTNKPRKSFVIDSISYDVLKAACKS
Q70HB1_FPV039-01        MASSNMKDETYYIALNMIQNYIIEYNTNKPRKSFVIDSISYDVLKAACKS
Q9J5G4_FPV039-01        MASSNMKDETYYIALNMIQNYIIEYNTNKPRKSFVIDSISYDVLKAACKS
                        **************************************************

A0A385HA64_FPV039-      VIKTNYNEFDIIISRNIDFNVIVTQVLEDKINWGRIITIIAFCAYYSKKV
Q70HB1_FPV039-01        VIKTNYNEFDIIISRNIDFNVIVTQVLEDKINWGRIITIIAFCAYYSKKV
Q9J5G4_FPV039-01        VIKTNYNEFDIIISRNIDFNVIVTQVLEDKINWGRIITIIAFCAYYSKKV
                        **************************************************

A0A385HA64_FPV039-      KQDTSPQYYDGIISEAITDAILSKYRSWFIDQDYWNGIRIYKNYSYIFNT
Q70HB1_FPV039-01        KQDTSPQYYDGIISEAITDAILSKYRSWFIDQDYWNGIRIYKNYSYIFNT
Q9J5G4_FPV039-01        KQDTSPQYYDGIISEAITDAILSKYRSWFIDQDYWNGIRIYKNYSYIFNT
                        **************************************************

A0A385HA64_FPV039-      ASYCIFTASLIIASLAVFKICSFYM
Q70HB1_FPV039-01        ASYCIFTASLIIASLAVFKICSFYM
Q9J5G4_FPV039-01        ASYCIFTASLIIASLAVFKICSFYM
                        *************************

© 1998-2019