Dataset for protein ORF115R of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q5GAF0_ORF115R-01      MTNINFSALLRGERMCPLTREIHSQMLIVTKSYSLVETFRAFPRLPNILE
Q5YFF0_ORF115R-01      MTNINFSALLRGERMCPLTREIHSQMLIVTKSYSLVETFRAFPRLPNILE
                       **************************************************

Q5GAF0_ORF115R-01      IGNNIVSDGNLNWGRILILLGISQLYFTKSESESERTQITEQLERFFRQD
Q5YFF0_ORF115R-01      IGNNIVSDGNLNWGRILILLGISQLYFTKSESESERTQITEQLERFFRQD
                       **************************************************

Q5GAF0_ORF115R-01      AISNWIASNGGWVTCASLDLRNYSSVTNALQAMCFFGALFGTIAVIAYYL
Q5YFF0_ORF115R-01      AISNWIVSNGGWVTCASLDLRNYSSVTNALQAMCFFGALFGTIAVIAYYL
                       ******.*******************************************

Q5GAF0_ORF115R-01      LP
Q5YFF0_ORF115R-01      LP
                       **

© 1998-2018