Dataset for protein 097R of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

29 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q6YH32_097R-01          MDVRQFLSDCEAPEEMVALRAAADAVGVDNMACAHLYTMLWEGVNLEEVH
A0A0U2QBA9_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNMACAHLYTMLWEGINLEEVH
A0A0U2QHX4_097R-01      MDVRQFLLDCEAPEEMVALRAAADAVGVDNMACAHLYTMLWEGVNLEEVH
A0A0U2R7T3_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNMACAHLYTMLWEGVNLEEVH
I2BFW4_097R-01          MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEDVH
D3TTY2_097R-01          MGVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
Q2WEP2_097R-01          MDVRQFLSDCEAPEEMVALRAAADAVGVDNRAFAHLYTMLWEGVNLEEVH
H9XFR8_097R-01          MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVSLEEVH
H6WEE3_097R-01          MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
A0A220IH18_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
A0A1B2ITU5_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
A0A0D3R3I2_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGIDNRACAHLYTMLWEGVNLEEVH
Q6GZM8_097R-01          MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
W8TMV3_097R-01          MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
A0A223PJ87_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
A0A2P1GJP0_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
C3RWV2_097R-01          MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
A0A2U9QGY4_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
A0A2U9QHH2_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
A0A192GQ13_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNKACAHLYTMLWEGVNLEEVH
A0A0A0VDG1_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
A0A2D0XKG8_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
A0A2D0XMC5_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
A0A222NTN8_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
A0A0D3R3S5_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
T2C510_097R-01          MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
V5N073_097R-01          MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
A0A223PJJ8_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACTHLYTMLWEGVNLEEVH
A0A222NTZ1_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
                        *.***** *******************:** * :*********:.**:**

Q6YH32_097R-01          ASFLGDGVVNWGRVAAFMHICRYTVRTFPSSMDRTEVALTKFIQDPKIYK
A0A0U2QBA9_097R-01      ASFLGDGVVNWGRVAAFMHICRYTVRTFPSSMDRTEVALTKFIQDPKIYK
A0A0U2QHX4_097R-01      ASFLGDGVVNWGRVAAFMHICRYTVRTFPSSMDRTEVALTKFIQDPKIYK
A0A0U2R7T3_097R-01      ASFLGDGVVNWGRVAAFMHICRYTVRTFPSSMDRTEVALTKFIQDPKIYK
I2BFW4_097R-01          ASLLGDGVVNWGRVAAFMHVCRYTVRTFPSSMDRTEVALTKFIQDPRVDK
D3TTY2_097R-01          ASLLGDGIVNWGRVAAFMHICRYTVRTFPSSMDRTEVALTKFIQDPKIDE
Q2WEP2_097R-01          ASLLRDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
H9XFR8_097R-01          ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
H6WEE3_097R-01          ASLLGDGVVNWGRMAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
A0A220IH18_097R-01      ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
A0A1B2ITU5_097R-01      ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
A0A0D3R3I2_097R-01      ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
Q6GZM8_097R-01          ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
W8TMV3_097R-01          ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
A0A223PJ87_097R-01      ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
A0A2P1GJP0_097R-01      ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
C3RWV2_097R-01          ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
A0A2U9QGY4_097R-01      ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
A0A2U9QHH2_097R-01      ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
A0A192GQ13_097R-01      ASLLGDGVVNWGRVAVFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
A0A0A0VDG1_097R-01      ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
A0A2D0XKG8_097R-01      ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
A0A2D0XMC5_097R-01      ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
A0A222NTN8_097R-01      ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
A0A0D3R3S5_097R-01      ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
T2C510_097R-01          ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
V5N073_097R-01          ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
A0A223PJJ8_097R-01      ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
A0A222NTZ1_097R-01      ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
                        **:* **:*****:*.***:*** **********************.: :

Q6YH32_097R-01          HLREWTDRLGTVGVIGRCL-----KWLGA--------GVI----TGVVLS
A0A0U2QBA9_097R-01      HLREWTDRLGTVGVIGRCL-----KWLGA--------GVI----TGVVLS
A0A0U2QHX4_097R-01      HLREWTDRLGTVGVIGRCL-----KWLGA--------GVI----TGVVLS
A0A0U2R7T3_097R-01      HLREWTDRLGTVGVIGRCL-----KWLGA--------GVI----TGVVLS
I2BFW4_097R-01          HLREWTDRLGTVGVIGRCLEWLEREWLGV--------GVITGVITGVVLS
D3TTY2_097R-01          HLREWTDRLGTVGVIGRCL-----EWLGA--------GVI----TGVVLS
Q2WEP2_097R-01          QLREWTDRLGTVGVIGKCL-----EWLGAGVITGVITGVITGVITGVILS
H9XFR8_097R-01          QLREWTDRLGTVGVIGRCL-----EWLGA--------GVI----TGVVLS
H6WEE3_097R-01          QLREWTDRLGTVGVIGRCL-----EWLGA--------GVI----TGVVLS
A0A220IH18_097R-01      QLREWTDRLGTVGVIGRCL-----EWLGA--------GVI----TGVVLS
A0A1B2ITU5_097R-01      QLREWTDRLGTVGVIGRCL-----EWLGA--------GVI----TGVVLS
A0A0D3R3I2_097R-01      QLREWTDRLGTVGVIGRCL-----EWLGV--------GVI----TGVVLS
Q6GZM8_097R-01          QLREWTDRLGTVGLIGRCL-----EWLGA--------GVI----TGVVLS
W8TMV3_097R-01          QLREWTDRLGTVGVIGRCL-----EWLGA--------GVI----TGVVLS
A0A223PJ87_097R-01      QLREWTDRLGTVGVIGRCL-----EWLGA--------GVI----TGVVLS
A0A2P1GJP0_097R-01      QLREWTDRLGTVGVIGRCL-----EWLGA--------GVI----TGVVLS
C3RWV2_097R-01          QLREWTDRLGTVGVIGRCL-----EWLGA--------GVI----TGVVLS
A0A2U9QGY4_097R-01      QLREWTDRLGTVGVIGRCL-----EWLGA--------GVI----TGVVLS
A0A2U9QHH2_097R-01      QLREWTDRLGTVGVIGRCL-----EWLGA--------GVI----TGVVLS
A0A192GQ13_097R-01      QLREWTDRLGTVGVIGRCL-----EWLGA----GAIAGVI----AGVVLS
A0A0A0VDG1_097R-01      QLREWTDRLGTVGVIGRCL-----EWLGA----GVITGVITGVITGVVLS
A0A2D0XKG8_097R-01      QLREWTDRLGTVGVIGRCL-----EWLGA----GVITGVI----TGVVLS
A0A2D0XMC5_097R-01      QLREWTDRLGTVRVIGRCL-----EWLGA----GVITGVI----TGVVLS
A0A222NTN8_097R-01      QLREWTDRLGTVRVIGRCL-----EWLGA----GVITGVI----TGVVLS
A0A0D3R3S5_097R-01      QLREWTDRLGTVRVIGRCL-----EWLGA----GVITGVI----TGVVLS
T2C510_097R-01          QLREWTDRLGTVRVIGRCL-----EWLGA--------GVI----TGVVLS
V5N073_097R-01          QLREWTDRLGTVRVIGRCL-----EWLGA--------GVI----TGVVLS
A0A223PJJ8_097R-01      QLREWTDRLGTVRVIGRCL-----EWLGA--------GVI----TGVVLS
A0A222NTZ1_097R-01      QLREWTDRLGTVRVIGRCL-----EWLGA--------GVI----TGVVLS
                        :*********** :**.**     :***.        ***    :**:**

Q6YH32_097R-01          LLFS
A0A0U2QBA9_097R-01      LLFS
A0A0U2QHX4_097R-01      LLFS
A0A0U2R7T3_097R-01      LLFS
I2BFW4_097R-01          LLFS
D3TTY2_097R-01          LLFS
Q2WEP2_097R-01          LLFS
H9XFR8_097R-01          LLFY
H6WEE3_097R-01          LLFS
A0A220IH18_097R-01      LLFS
A0A1B2ITU5_097R-01      LLFS
A0A0D3R3I2_097R-01      LLFS
Q6GZM8_097R-01          LLFY
W8TMV3_097R-01          LLFY
A0A223PJ87_097R-01      LLFY
A0A2P1GJP0_097R-01      LLFY
C3RWV2_097R-01          LLFY
A0A2U9QGY4_097R-01      LLFY
A0A2U9QHH2_097R-01      LLFY
A0A192GQ13_097R-01      LLFS
A0A0A0VDG1_097R-01      LLFS
A0A2D0XKG8_097R-01      LLFS
A0A2D0XMC5_097R-01      LLFS
A0A222NTN8_097R-01      LLFS
A0A0D3R3S5_097R-01      LLFS
T2C510_097R-01          LLFS
V5N073_097R-01          LLFS
A0A223PJJ8_097R-01      LLFS
A0A222NTZ1_097R-01      LLFS
                        *** 

© 1998-2018