Dataset for protein 097R of organism Lumpfish ranavirus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q9T2R6_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNSACAHLYTMHWEGVNLEEVH
A0A3Q9T8U5_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMQWEGVNLEEVH
                        ****************************** ********:**********

A0A3Q9T2R6_097R-01      ASLLGDGVVNWGRVAVFMHVCRYTVRTFPSSMDRTEVALTKFIQDPKIYK
A0A3Q9T8U5_097R-01      ASLLGDGVVNWGRVAVFMHICRYTVRTFPSSMDRTEVALTKFIQDPKIYK
                        *******************:******************************

A0A3Q9T2R6_097R-01      HLREWTDRLGTVGVIGRCLEWLGAGVITGVITGVVLSLLSLLSLLFS
A0A3Q9T8U5_097R-01      HLREWTDRLGTVGVIGRCLEWLGAGVITGVITGVV------LSLLFS
                        ***********************************      ******

© 1998-2019