Dataset for protein 097R of organism Frog virus 3

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A220IH18_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
Q6GZM8_097R-01          MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
W8TMV3_097R-01          MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
                        **************************************************

A0A220IH18_097R-01      ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
Q6GZM8_097R-01          ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
W8TMV3_097R-01          ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
                        **************************************************

A0A220IH18_097R-01      QLREWTDRLGTVGVIGRCLEWLGAGVITGVVLSLLFS
Q6GZM8_097R-01          QLREWTDRLGTVGLIGRCLEWLGAGVITGVVLSLLFY
W8TMV3_097R-01          QLREWTDRLGTVGVIGRCLEWLGAGVITGVVLSLLFY
                        *************:********************** 

© 1998-2018