Dataset for protein 097R of organism Common midwife toad virus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


H6WEE3_097R-01          MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
A0A0A0VDG1_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
A0A2D0XKG8_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
A0A2D0XMC5_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNRACAHLYTMLWEGVNLEEVH
                        **************************************************

H6WEE3_097R-01          ASLLGDGVVNWGRMAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
A0A0A0VDG1_097R-01      ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
A0A2D0XKG8_097R-01      ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
A0A2D0XMC5_097R-01      ASLLGDGVVNWGRVAAFMHICRYIVRTFPSSMDRTEVALTKFIQDPKIDK
                        *************:************************************

H6WEE3_097R-01          QLREWTDRLGTVGVIGRCLEWLGAGVI--------TGVVLSLLFS
A0A0A0VDG1_097R-01      QLREWTDRLGTVGVIGRCLEWLGAGVITGVITGVITGVVLSLLFS
A0A2D0XKG8_097R-01      QLREWTDRLGTVGVIGRCLEWLGAGVITGVI----TGVVLSLLFS
A0A2D0XMC5_097R-01      QLREWTDRLGTVRVIGRCLEWLGAGVITGVI----TGVVLSLLFS
                        ************ **************        **********

© 1998-2018