Dataset for protein 097R of organism Ambystoma tigrinum virus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A0U2QBA9_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNMACAHLYTMLWEGINLEEVH
A0A0U2QHX4_097R-01      MDVRQFLLDCEAPEEMVALRAAADAVGVDNMACAHLYTMLWEGVNLEEVH
A0A0U2R7T3_097R-01      MDVRQFLSDCEAPEEMVALRAAADAVGVDNMACAHLYTMLWEGVNLEEVH
                        ******* ***********************************:******

A0A0U2QBA9_097R-01      ASFLGDGVVNWGRVAAFMHICRYTVRTFPSSMDRTEVALTKFIQDPKIYK
A0A0U2QHX4_097R-01      ASFLGDGVVNWGRVAAFMHICRYTVRTFPSSMDRTEVALTKFIQDPKIYK
A0A0U2R7T3_097R-01      ASFLGDGVVNWGRVAAFMHICRYTVRTFPSSMDRTEVALTKFIQDPKIYK
                        **************************************************

A0A0U2QBA9_097R-01      HLREWTDRLGTVGVIGRCLKWLGAGVITGVVLSLLFS
A0A0U2QHX4_097R-01      HLREWTDRLGTVGVIGRCLKWLGAGVITGVVLSLLFS
A0A0U2R7T3_097R-01      HLREWTDRLGTVGVIGRCLKWLGAGVITGVVLSLLFS
                        *************************************

© 1998-2018