Dataset for protein M11 of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


P89884_M11-01      MSHKKSGTYWATLITAFLKTVSKVEELDCVDSAVLVDVSKIITLTQEFRRHYDSVYRADY
B1PZP0_M11-01      MSHKKSGTYWATLITAFLKTVSKVEELDCVDSAVLVDVSKIITLTQEFRRHYDSVYRADY
D0U1R1_M11-01      MSHKRTGTYWATIITAFLKSVSKVEELDCYDSDVLDDVSKIITLTQEFRSHYDSVFHMDY
                   ****.:******:******:********* ** ** ************* *****:. **

P89884_M11-01      GPALKNWKRDLSKLFTSLFVDVINSGRIVGFFDVGRYVCEEVLCPGSWTEDHELLNDCMT
B1PZP0_M11-01      GPALKNWKRDLSKLFTSLFVDVINSGRIVGFFDVGRYVCEEVLCPGSWTEDHELLNDCMT
D0U1R1_M11-01      GPALQNWKGGLARLFTSLFGDAINRGRIVGFFDVGRYVCEELLCPGSWTEEHDLLNEYMT
                   ****:*** .*:.****** *.** ****************:********:*:***: **

P89884_M11-01      HFFIENNLMNHFPLEDIFLAQRKFQTTGFTFLLHALAKVLPRIYSGNVIYV
B1PZP0_M11-01      HFFIENNLMNHFPLEDIFLAQRKFQTTGFTFLLHALAKVLPRIYSGNVIYV
D0U1R1_M11-01      QFFIENNLMNYFSLEDTFCTQTKFHNMGFSLALSILCRALTRIYSGDVIYV
                   :*********:*.*** * :* **:. **:: *  *...*.*****:****

© 1998-2018