Dataset for protein herpesviridae of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

104 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q1XBS6_VBCL2-01         MSLFFVVWYWVNYITKVCSGEVYIPSVLKFQYHSDTEHEPYSNLCENLIT
Q1XBS8_VBCL2-01         MSLFFIVWYWVNYITKVCSGEVYIPSVLKFQYHSDTEHEPYSNLCENLIT
Q1XBS7_VBCL2-01         MSLFFVVWYWVNYITKVCSGEVYIPSVLKFQYHSDTEHEPYSNLCENLIT
Q99D15_VBCL2-01         MSLFFVVWYWVNYITKVCFGEVYIPSVLKFQYHSDTEHEPYSNLCKNLIT
Q9WH78_VBCL2-01         MSLFFVVWYWVNYITKVCSGEVYIPSVLKFQYHSDTEHEPYSNLCKNLIT
A1BM64_A9-01            ------------MVEAGILSRKVTTGSHWTFFTPQTLKKGACLWKAGAVY
Q2VSG7_A9-01            ------------MVEAGILSRKVTTGSHWTFFTPQTLKKGACLWKAGAVY
A0A1L2JVL1_A9-01        -----------------------------------MKMLGEPEFKENILY
O36423_A9-01            -----------------------------------MKMLGEPEFKENILY
Q9Q5K8_BHRF1-01         --------------------MAYSTRDLLLALCMRDGHVYGGDGLHPVLE
Q9WGB5_BHRF1-01         --------------------MAYSTRDLLLALCMRDGHVYGGDGLHPVLE
Q9IHR2_BHRF1-01         --------------------MAYSTRDILLALCMRDSYVHGNGSLHPVLE
A0A0S2YQS0_BHRF1-0      --------------------MAHSTREILLALCIRDSRVHGNGVLHPVLE
A0A2H4Z4F2_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A385J922_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A385J8Q6_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A385J7D0_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2S1N3U3_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2S1MYK7_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2S1MX38_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2S1MWX4_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2S1MNB9_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2H4Z4H8_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNASLHPVLE
A0A2H4Z4E3_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2H4Z4D9_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0C7U1E2_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0C7TWM2_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2D1LYW3_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0C7TTN2_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0C7TQI4_BHRF1-0      --------------------MAYSTRDILLALCIRDSRVHGNGALHPVLE
A0A2H4Z4I0_BHRF1-0      --------------------MAYSTRDILLALCIRDSRVHGNGALHPVLE
A0A0C7TNT4_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0C7TK05_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0C7T924_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0C7T306_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0C7SXB3_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2H4Z4C5_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2S1MW70_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0B6VHG4_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0X9C4Q9_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2H4Z4I4_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGSLHPVLE
A0A2H4Z4M5_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGSLHPVLE
A0A2S1N164_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
G3CKQ0_BHRF1-01         --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2H4Z4D6_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2S1N3G0_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
V5KUE2_BHRF1-02         --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A385JAL1_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0S2YRE8_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
V5KU29_BHRF1-02         --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0C7T6R4_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0C7TX82_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0X8YIW3_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2H4Z4F8_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGILHPVLE
A0A2S1MMY2_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
P0C6Z1_BHRF1-01         --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
P03182_BHRF1-01         --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
K9UTN7_BHRF1-01         --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A385J9R2_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
K9UTF7_BHRF1-01         --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
P89884_M11-01           ----------------------------------------MSHKKSGTYW
B1PZP0_M11-01           ----------------------------------------MSHKKSGTYW
D0U1R1_M11-01           ----------------------------------------MSHKRTGTYW
A0A385JAB4_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDAVFV
A0A2S1N1Z2_BALF1-0      MNRAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1N2H2_BALF1-0      MNRAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MZQ8_BALF1-0      MNLAITLDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A385J7X7_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MXY9_BALF1-0      MNLAIALDFPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MU91_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MQV1_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A0U3UKR9_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVNWPDETMRPAKSTDSVFV
A0A0U3U737_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A0S2YQW9_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRQAKSTDSVFV
A0A2S1MV59_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MM94_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MP06_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MTH2_BALF1-0      MNLAIALDSHHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A385J8K7_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
U5YUM6_BALF1-01         MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
Q91HV2_BALF1-01         MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
P0CK59_BALF1-01         MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A385JB67_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
P0CK58_BALF1-01         MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A0C7TV67_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A0C7TUX3_BALF1-0      --------------------------------------MRQAKSTDSVFV
A0A0C7TPI3_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A0C7TLW1_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A075FFB0_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A075FCZ0_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A0C7T8J1_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A0C7TJ32_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A2D1LYV4_BALF1-0      --------------------------------------MRPAKSTDSVFV
K9UT94_BALF1-01         --------------------------------------MRPAKSTDSVFV
Q99F65_BALF1-01         --------------------------------------MRPAESTDSVFV
Q99F66_BALF1-01         --------------------------------------MKAAKSTDSVFV
Q91HI3_BALF1-01         --------------------------------------MRPAKSTDSVFV
P90504_ORF16-01         --------------------------------------------------
F5HGJ3_ORF16-01         --------------------------------------------------
Q76RI8_ORF16-01         --------------------------------------------------
H3ALX7_vNR13-01         --------------------------------------------------
Q90343_vNR13-01         --------------------------------------------------
Q9E1F2_vNR13-01         --------------------------------------------------
Q9E1F2_vNR13-02         --------------------------------------------------
                                                                          

Q1XBS6_VBCL2-01         MAEQDMDEVVSTIRRLLVECGMGLE---EYLDHPVTAPIKVAVQDVIRTK
Q1XBS8_VBCL2-01         MAEQDMDEVVSTIRRLLVECGMGLE---EYLDHPVTAPIKVAVQDVIRTK
Q1XBS7_VBCL2-01         MAEQDMDEVVSTIRRLLVECGMGLE---EYLEHPVTAPIKVAVQDVIRTK
Q99D15_VBCL2-01         MAEQDMDEVVSTIRRLLVECGMGLE---EYLEHPVTAPIKVAVQDVIRTK
Q9WH78_VBCL2-01         MAEQDMDEVVSTIRRLLVECGMGLE---EYLEHPVTAPIKVAVQDVIRTK
A1BM64_A9-01            FPPASMPPRKAFNDGDLLYFNFTREIHMLLIKSGIPCSYAKGIMRAARTK
Q2VSG7_A9-01            FPPVSMPPRKAFNDGDLLYFNFTREIHMLLIKSGIPCSYAKGIMRAARTK
A0A1L2JVL1_A9-01        YSFLNELFLILIRNGFSCSHAKLIL-------------------DETRKR
O36423_A9-01            YSFLNELFLILIRNGFSCSHAKLIL-------------------DETRKR
Q9Q5K8_BHRF1-01         LTARESPFSVSPGDPLVLRLHALLE-------------------QIIVQN
Q9WGB5_BHRF1-01         LTARESPFSVSPGDPLVLRLHALLE-------------------QIIVQN
Q9IHR2_BHRF1-01         LAARETPPRVSPEDTVVLRLHLLLE-------------------EVIQQN
A0A0S2YQS0_BHRF1-0      LAARETPPRVSPEDTVVLRYHVLLE-------------------EIIERN
A0A2H4Z4F2_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLE-------------------EIIERN
A0A385J922_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLE-------------------EIIERN
A0A385J8Q6_BHRF1-0      LAARETPLCLSPEDTVVLRYHVLLE-------------------EIIERN
A0A385J7D0_BHRF1-0      LAARETLLRLSPEDTVVLRYHVLLE-------------------EIIERN
A0A2S1N3U3_BHRF1-0      LATRETPLRLSPEDTVVLRYHVLLE-------------------EIIERN
A0A2S1MYK7_BHRF1-0      LAARETPLCLSPEDTVVLRYHVLLE-------------------EIIERN
A0A2S1MX38_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLE-------------------EIIERN
A0A2S1MWX4_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLE-------------------EIIERN
A0A2S1MNB9_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLE-------------------EIIERN
A0A2H4Z4H8_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLE-------------------EIIERN
A0A2H4Z4E3_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLE-------------------EIIERN
A0A2H4Z4D9_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLE-------------------EIIERN
A0A0C7U1E2_BHRF1-0      LASRETPLRLSPEDTVVLRYHVLLE-------------------EIIERN
A0A0C7TWM2_BHRF1-0      LAARETPLRLLPEDTVVLRYHVLLE-------------------EIIERN
A0A2D1LYW3_BHRF1-0      LAARETPLRLLPEDTVVLRYHVLLE-------------------EIIERN
A0A0C7TTN2_BHRF1-0      LAARETPLHLSPEDTVVLRYHVLLE-------------------EIIERN
A0A0C7TQI4_BHRF1-0      LAARETPPRLSPEDTVVLRYHVLLE-------------------EIIERN
A0A2H4Z4I0_BHRF1-0      LAARETPPRLSPEDTVVLRYHVLLE-------------------EIIERN
A0A0C7TNT4_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLE-------------------EIIERN
A0A0C7TK05_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLE-------------------EIIERN
A0A0C7T924_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLE-------------------EIIERN
A0A0C7T306_BHRF1-0      LAARETHLRLSPEDTVVLRYHVLLE-------------------EIIERN
A0A0C7SXB3_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLE-------------------EIIERN
A0A2H4Z4C5_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLE-------------------EIIERN
A0A2S1MW70_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLE-------------------EIIERN
A0A0B6VHG4_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLE-------------------EIIERN
A0A0X9C4Q9_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLE-------------------EIIERN
A0A2H4Z4I4_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLE-------------------EIIERN
A0A2H4Z4M5_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLE-------------------EIIERN
A0A2S1N164_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLE-------------------EIIERN
G3CKQ0_BHRF1-01         LAARETPLRLSPEDTVVLRYHVLLE-------------------EIIERN
A0A2H4Z4D6_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLE-------------------EIIERN
A0A2S1N3G0_BHRF1-0      LASRETPLRLSPEDTVVLRYHVLLE-------------------EIIERN
V5KUE2_BHRF1-02         LASRETPLRLSPEDTVVLRYHVLLE-------------------EIIERN
A0A385JAL1_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLE-------------------EIIERN
A0A0S2YRE8_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLE-------------------EIIERN
V5KU29_BHRF1-02         LAARETPLRLSPEDTVVLRYHVLLE-------------------EIIERN
A0A0C7T6R4_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLE-------------------EIIERN
A0A0C7TX82_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLE-------------------EIIERN
A0A0X8YIW3_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLE-------------------EIIERN
A0A2H4Z4F8_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLE-------------------EIIERN
A0A2S1MMY2_BHRF1-0      LAARESPLRLSPEDTVVLRYHVLLE-------------------EIIERN
P0C6Z1_BHRF1-01         LAARETPLRLSPEDTVVLRYHVLLE-------------------EIIERN
P03182_BHRF1-01         LAARETPLRLSPEDTVVLRYHVLLE-------------------EIIERN
K9UTN7_BHRF1-01         LAARETPLRLSPEDTVVLRYHVLLE-------------------EIIERN
A0A385J9R2_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLE-------------------EIIERN
K9UTF7_BHRF1-01         LAARETPLRLSPEDTVVLRYHVLLE-------------------EIIERN
P89884_M11-01           ATLITAFLKTVSKV----------E-------------------ELDCVD
B1PZP0_M11-01           ATLITAFLKTVSKV----------E-------------------ELDCVD
D0U1R1_M11-01           ATIITAFLKSVSKV----------E-------------------ELDCYD
A0A385JAB4_BALF1-0      RTPVEAWVAPSPPD----------D-------------------KVAESS
A0A2S1N1Z2_BALF1-0      RTPVEAWVAPSPPD----------D-------------------KVAESS
A0A2S1N2H2_BALF1-0      RTPVEAWVAPSPPD----------D-------------------KVAESS
A0A2S1MZQ8_BALF1-0      RTPVEAWVAPSPPD----------D-------------------KVAESS
A0A385J7X7_BALF1-0      RTPVEAWVAPSPPD----------D-------------------KVAESS
A0A2S1MXY9_BALF1-0      RTPVEAWVAPSPPD----------D-------------------KVAESS
A0A2S1MU91_BALF1-0      RTPVEAWVAPSPPD----------D-------------------KVAESS
A0A2S1MQV1_BALF1-0      RTPVEAWVAPSPPD----------D-------------------KVAESS
A0A0U3UKR9_BALF1-0      RTPVEAWVAPSPPD----------D-------------------KVAESS
A0A0U3U737_BALF1-0      RTPVEAWVAPSPPD----------D-------------------KVAESS
A0A0S2YQW9_BALF1-0      RTPVEAWVAPSPPD----------D-------------------KVAESS
A0A2S1MV59_BALF1-0      RTPVEAWVAPLPPD----------D-------------------KVAESS
A0A2S1MM94_BALF1-0      RTPVEAWVAPSPPD----------D-------------------KVAESS
A0A2S1MP06_BALF1-0      RTPVEAWVAPSPPD----------D-------------------KVAESS
A0A2S1MTH2_BALF1-0      RTPVEAWVAPSPPD----------D-------------------KVAESS
A0A385J8K7_BALF1-0      RTPVEAWVAPSPPD----------D-------------------KVAESS
U5YUM6_BALF1-01         KTPVEAWVAPSPPD----------D-------------------KVAESS
Q91HV2_BALF1-01         RTPVEAWVAPSPPD----------D-------------------KVAESS
P0CK59_BALF1-01         RTPVEAWVAPSPPD----------D-------------------KVAESS
A0A385JB67_BALF1-0      RTPVEAWVAPSPPD----------D-------------------KVAESS
P0CK58_BALF1-01         RTPVEAWVAPSPPD----------D-------------------KVAESS
A0A0C7TV67_BALF1-0      RTPVEAWVAPSPPD----------D-------------------KVAESS
A0A0C7TUX3_BALF1-0      RTPVEAWVAPSPPD----------D-------------------KVAESS
A0A0C7TPI3_BALF1-0      RTPVEAWVAPSPPD----------D-------------------KVAESS
A0A0C7TLW1_BALF1-0      RTPVEAWVAPSPPD----------D-------------------KVAESS
A0A075FFB0_BALF1-0      RTPVEAWVAPSPPD----------D-------------------KVAESS
A0A075FCZ0_BALF1-0      RTPVEAWVAPSPPD----------D-------------------KVAESS
A0A0C7T8J1_BALF1-0      RTPVEAWVAPSPPD----------D-------------------KVAESS
A0A0C7TJ32_BALF1-0      RTPVEAWVAPSPPD----------D-------------------KVAESS
A0A2D1LYV4_BALF1-0      RTPVEAWVAPSPPD----------D-------------------KVAESS
K9UT94_BALF1-01         RTPVEAWVAPSPPD----------D-------------------KVAESS
Q99F65_BALF1-01         RTPVEAWVAPSPPD----------D-------------------KVAESS
Q99F66_BALF1-01         RTPVEAWVSPSPPD----------D-------------------KVAETS
Q91HI3_BALF1-01         RTPVEAWVAPSPPD----------D-------------------KVAESS
P90504_ORF16-01         ------------MD----------E-------------------DVLPGE
F5HGJ3_ORF16-01         ------------MD----------E-------------------DVLPGE
Q76RI8_ORF16-01         ------------MD----------E-------------------DVLPGE
H3ALX7_vNR13-01         ------------MC----------D-------------------SLKEET
Q90343_vNR13-01         ------------MP----------G-------------------SLKEET
Q9E1F2_vNR13-01         ------------MA----------D-------------------SLKEET
Q9E1F2_vNR13-02         ------------MA----------D-------------------SLKEET
                                                                          

Q1XBS6_VBCL2-01         QDIFSNFLTNINSVEDLETLGHAITTLNDY--PSPNMGRVVCGIAFSVYV
Q1XBS8_VBCL2-01         QDIFSNFLTNINSVEDLETLGHAITTLNDY--PSPNMGRVVCGIAFSVYV
Q1XBS7_VBCL2-01         QDIFSNFLTNINSVEDLETLGHAITTLNDY--PSPNMGRVVCGIAFSVYV
Q99D15_VBCL2-01         QDIFSNFLTNINSVEDLETLGHAITTLNDY--PSPNMGRVVCGIAFSVYV
Q9WH78_VBCL2-01         QDIFSNFLTNINSVEDLETLGHAITTLNDY--PSPNMGRVVCGIAFSVYV
A1BM64_A9-01            AVDCSSTFEVIVDGVGHPSPESLERIAKSLFTPRPNWGRVVMFFAYLF--
Q2VSG7_A9-01            AVDCSSTFEVIVDGVGHPSPESLERIAKSLFTPRPNWGRVVMFFAYLF--
A0A1L2JVL1_A9-01        GLECSGQFEVISNSVEAPEPESLERIAKTLFTPRPHWGRLVAFLAYL---
O36423_A9-01            GLECSGQFEVISNSVEAPEPESLERIAKTLFTPRPHWGRLVAFLAYL---
Q9Q5K8_BHRF1-01         EDAFAETLVTFLLNTEDLDLDFSRVFAEIFHNEDPTLGRGLAWLAWCMHA
Q9WGB5_BHRF1-01         EDAFAETLDRFLLNTEDLDLDFSRVFAEIFHNEDPTLGRGLAWLAWCMHA
Q9IHR2_BHRF1-01         AESFTNTWETFITNAEHVDLDFAAVFEDIFHRGDPSLGRALAWLAWCMHA
A0A0S2YQS0_BHRF1-0      SDTFTETWDRFITHTEHLDLDFNSIFLEIFHRGDPSRGRALAWLAWCMHA
A0A2H4Z4F2_BHRF1-0      SETFTETWNRFITHTEHLDLDFNSVFLEIFHRGDPSLGCALTWMAWGMHA
A0A385J922_BHRF1-0      SETFTETWNRFITHTEHVDLDFNSVFVEIFHRGDPSLGRALAWMAWCMHA
A0A385J8Q6_BHRF1-0      SETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHA
A0A385J7D0_BHRF1-0      SETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHA
A0A2S1N3U3_BHRF1-0      SETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHA
A0A2S1MYK7_BHRF1-0      SETFTETWNRFITHTEHLDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHA
A0A2S1MX38_BHRF1-0      SETFTETWNRFLTHTEHLDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHA
A0A2S1MWX4_BHRF1-0      SETFTETWNRFTTHTEHLDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHA
A0A2S1MNB9_BHRF1-0      SETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHA
A0A2H4Z4H8_BHRF1-0      SETFTETWNRFITHTEHLDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHA
A0A2H4Z4E3_BHRF1-0      SETFTETWNSFITHTEHVDLDFNSVFVEIFHRGDPSLGRALAWMAWCMHA
A0A2H4Z4D9_BHRF1-0      SETFTETWNRFITHTEHVDLDFNSVFVEIFHRGDPSLGRALAWMAWCMHA
A0A0C7U1E2_BHRF1-0      SETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHA
A0A0C7TWM2_BHRF1-0      SETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHA
A0A2D1LYW3_BHRF1-0      SETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHA
A0A0C7TTN2_BHRF1-0      SETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHA
A0A0C7TQI4_BHRF1-0      SETFTETWNRFITHTENLDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHA
A0A2H4Z4I0_BHRF1-0      SETFTETWNRFITHTEHLDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHA
A0A0C7TNT4_BHRF1-0      SETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRTLAWMAWCMHA
A0A0C7TK05_BHRF1-0      SETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHA
A0A0C7T924_BHRF1-0      SETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHA
A0A0C7T306_BHRF1-0      SETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHA
A0A0C7SXB3_BHRF1-0      SETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHA
A0A2H4Z4C5_BHRF1-0      SETFTETWNRFITHTDHLDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHA
A0A2S1MW70_BHRF1-0      SETFTETWNRFITHTGHLDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHA
A0A0B6VHG4_BHRF1-0      SETFTETWNRFITHTENLDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHA
A0A0X9C4Q9_BHRF1-0      SETFTETWNRFIRHTEHLDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHA
A0A2H4Z4I4_BHRF1-0      SETFTETWNRFITHTEHLDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHA
A0A2H4Z4M5_BHRF1-0      SETFTETWNRFITHTEHLDLDFNSVFFEIFHRGDPSLGRALAWMAWCMHA
A0A2S1N164_BHRF1-0      SETFTETWNRFITHTEHLDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHA
G3CKQ0_BHRF1-01         SETFTETWNRFITHTEHLDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHA
A0A2H4Z4D6_BHRF1-0      SETFTETWNRFITHTANLDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHA
A0A2S1N3G0_BHRF1-0      SETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHA
V5KUE2_BHRF1-02         SETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHA
A0A385JAL1_BHRF1-0      SETFTETWNRFITYTEHVDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHA
A0A0S2YRE8_BHRF1-0      SETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPRLGRALAWMAWCMHA
V5KU29_BHRF1-02         SETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHA
A0A0C7T6R4_BHRF1-0      SETFSETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHA
A0A0C7TX82_BHRF1-0      SETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRALAWMAWCMYA
A0A0X8YIW3_BHRF1-0      SETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHA
A0A2H4Z4F8_BHRF1-0      SETFTETWNRFITHTEHVDLDFNSVFVEIFHRGDPSLGRALAWMAWCMHA
A0A2S1MMY2_BHRF1-0      SETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHA
P0C6Z1_BHRF1-01         SETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHA
P03182_BHRF1-01         SETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHA
K9UTN7_BHRF1-01         SETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHA
A0A385J9R2_BHRF1-0      SETFTETWNRFITHTEHVDLDFNSVFLEIFHRGXPSLGRALAWMAWCMHA
K9UTF7_BHRF1-01         SETFTETWNRFITHTEHVDLDFNSVFVEIFHRGDPSLGRALAWMAWCMHA
P89884_M11-01           SAVLVDVSKII----------------------TLTQEFRR-HYDS----
B1PZP0_M11-01           SAVLVDVSKII----------------------TLTQEFRR-HYDS----
D0U1R1_M11-01           SDVLDDVSKII----------------------TLTQEFRS-HYDS----
A0A385JAB4_BALF1-0      YLMFRAMYAVF-TRDEK-DLPLPALVLCRLIKASLRKDRKL-YAEL---A
A0A2S1N1Z2_BALF1-0      YLMFRAMYAVF-ARDEK-DLPLPALVLCRLIKASLRKDRKL-YTEL---A
A0A2S1N2H2_BALF1-0      YLMFRAMYAVF-ARDEK-DLPLPALVLCRLIKASLRKDRKL-YAEL---A
A0A2S1MZQ8_BALF1-0      YLMFRAMYAVF-ARDEK-DLPLPALVLCRLIKASLRKDRKL-YAEL---A
A0A385J7X7_BALF1-0      YLMFRAMYAVF-ARDEK-DLPLPALVLCRLIKASLRKDRKL-YAEL---A
A0A2S1MXY9_BALF1-0      YLMFRAMYAVF-TRDEK-DLPLPALVLCRLIKASLRKDRKL-YAEL---A
A0A2S1MU91_BALF1-0      YLMFRAMYAVF-TRDEK-DLPLPALVLCRLIKASLRKDREL-YAEL---A
A0A2S1MQV1_BALF1-0      YLMFRAMYAVF-TRDEK-DLPLPALVLCRLIKASLRKDRKL-YAEL---A
A0A0U3UKR9_BALF1-0      YLMFRAMYAVF-TRDEK-DLPLPALVLCRLIKASLRKDRKL-YAEL---A
A0A0U3U737_BALF1-0      YLMFRAMYAVF-TRDEK-DLPLPALVLCRLIKASLRKDRKL-YAEL---A
A0A0S2YQW9_BALF1-0      YLMFRAMYAVF-TRDEK-DLPLPALVLCRLIKASLRKDRKL-YAEL---A
A0A2S1MV59_BALF1-0      YLMFRAMYAVF-TRDEK-DLPLPALVLCRLIKASLRKDRKL-YAEL---A
A0A2S1MM94_BALF1-0      YLMFRAMYAVF-TRDEK-DLPLPALVLCRLIKASLRKDRKL-YAEL---A
A0A2S1MP06_BALF1-0      YLMFRAMYAVF-TRDEK-DLPLPALVLCRLIKASLRKDRKL-YAEL---A
A0A2S1MTH2_BALF1-0      YLMFRAMYAVF-TRDEK-DLPLPALVLCRLIKASLRKDRKL-YAEL---A
A0A385J8K7_BALF1-0      YLMFRAMYAVF-TRDEK-NLPLPALVLCRLIKASLRKDRKL-YAEL---A
U5YUM6_BALF1-01         YLMFRAMYAVF-TRDEK-DLPLPALVLCRLIKASLRKDRKL-YAEL---A
Q91HV2_BALF1-01         YLMFRAMYAVF-TRDEK-DLPLPALVLCRLIKASLRKDRKL-YAEL---A
P0CK59_BALF1-01         YLMFRAMYAVF-TRDEK-DLPLPALVLCRLIKASLRKDRKL-YAEL---A
A0A385JB67_BALF1-0      YLMFRAMYAVF-TRDEK-DLPLPALVLCRXXKAXLRKDRKL-YAEL---A
P0CK58_BALF1-01         YLMFRAMYAVF-TRDEK-DLPLPALVLCRLIKASLRKDRKL-YAEL---A
A0A0C7TV67_BALF1-0      YLMFRAMYAVF-ARDEK-DLPLPALVLCRLIKASLRKDRKL-YAEL---A
A0A0C7TUX3_BALF1-0      YLMFRAMYAVF-TRDEK-DLPLPALVLCRLIKASLRKDRKL-YAEL---A
A0A0C7TPI3_BALF1-0      YLMFRAMYAVF-TRDEK-DLPLPALVLCRLIKASLRKDRKL-YAEL---A
A0A0C7TLW1_BALF1-0      YLMFRAMYAVF-TRDEK-DLPLPALVLCRLIKASLRKDRKL-YADL---A
A0A075FFB0_BALF1-0      YLMFRAMYAVF-TRDEK-DLPLPALVLCRLIKASLRKDRRL-YAEL---A
A0A075FCZ0_BALF1-0      YLMFRAMYAVF-TRDEK-DLPLPALVLCRLIKASLRKDRKL-YAEL---A
A0A0C7T8J1_BALF1-0      YLMFRAMYAVF-TRDEK-DLPLPALVLCRLIKASLRKDRKL-YAEL---A
A0A0C7TJ32_BALF1-0      YLMFRAMYAVF-TRDEK-DLPLPALVLCRLIKASLRKDRKL-YAEL---A
A0A2D1LYV4_BALF1-0      YLMFRAMYAVF-TRDEK-DLPLPALVLCRLIKASLRKDRKL-YAEL---A
K9UT94_BALF1-01         YLMFRAMYAVF-TRDEK-DLPLPALVLCRLIKASLRKDRKL-YAEL---A
Q99F65_BALF1-01         YLMFRAMYAVF-SRDES-DLPLPAAVLCRLIKASLKKDRKL-YAEL---A
Q99F66_BALF1-01         YLLFRAMYAVF-TQDET-DLPTPAQVLCRLIKASLRKDKKL-YAEL---A
Q91HI3_BALF1-01         YLMFRAMYAVF-TQDET-GLPLPAMVLCRLIKASLKKDKKL-YAEL---A
P90504_ORF16-01         VLAIEGIFMACGLNEPE-YLYHPLLSPIKLYITGLMRDKES-LFEA----
F5HGJ3_ORF16-01         VLAIEGIFMACGLNEPE-YLYHPLLSPIKLYITGLMRDKES-LFEA----
Q76RI8_ORF16-01         VLAIEGIFMACGLNEPE-YLYHPLLSPIKLYITGLMRDKES-LFEA----
H3ALX7_vNR13-01         RLLANDFIQFC-LGSGR-TAPNPAARVLRRVTAELERQNQA-LFDSFQGN
Q90343_vNR13-01         ALLLEDYFQHR-AGGAA-LPPSATAAELRRAAAELERRERP-FFRS----
Q9E1F2_vNR13-01         ALLLEDYFQHC-CGKEG-PPPSPTAAELRRAAAELERRERP-FFRS----
Q9E1F2_vNR13-02         ALLLEDYFQHC-CGKEG-PPPSPTAAELRRAAAELERRERP-FFRS----
                                                                          

Q1XBS6_VBCL2-01         VQTVCKRKPLLV--------------------------------------
Q1XBS8_VBCL2-01         VQTVCKRKPLLV--------------------------------------
Q1XBS7_VBCL2-01         VQTVCKRKPLLV--------------------------------------
Q99D15_VBCL2-01         VQTVCKRKPLLV--------------------------------------
Q9WH78_VBCL2-01         VQTVCKRKPLLV--------------------------------------
A1BM64_A9-01            --------------------------------------------------
Q2VSG7_A9-01            --------------------------------------------------
A0A1L2JVL1_A9-01        --------------------------------------------------
O36423_A9-01            --------------------------------------------------
Q9Q5K8_BHRF1-01         CRTLCGDTNCP---------------------------------------
Q9WGB5_BHRF1-01         CRTLCGDTNCP---------------------------------------
Q9IHR2_BHRF1-01         CRTLCRNQNTP---------------------------------------
A0A0S2YQS0_BHRF1-0      CRTLCCNQDTP---------------------------------------
A0A2H4Z4F2_BHRF1-0      CWTLCCNQSTP---------------------------------------
A0A385J922_BHRF1-0      CRTLCCNQSTP---------------------------------------
A0A385J8Q6_BHRF1-0      CRTLCCNQSTP---------------------------------------
A0A385J7D0_BHRF1-0      CRTLCCNQSTP---------------------------------------
A0A2S1N3U3_BHRF1-0      CRTLCCNQSTP---------------------------------------
A0A2S1MYK7_BHRF1-0      CRTLCCNQSTP---------------------------------------
A0A2S1MX38_BHRF1-0      CRTLCCNQSTP---------------------------------------
A0A2S1MWX4_BHRF1-0      CRTLCCNQSTP---------------------------------------
A0A2S1MNB9_BHRF1-0      CRTLCCNQSTP---------------------------------------
A0A2H4Z4H8_BHRF1-0      CRTLCCNQSTP---------------------------------------
A0A2H4Z4E3_BHRF1-0      CRTLCCNQSTP---------------------------------------
A0A2H4Z4D9_BHRF1-0      CRTLCCNQSTP---------------------------------------
A0A0C7U1E2_BHRF1-0      CRTLCYNQSTP---------------------------------------
A0A0C7TWM2_BHRF1-0      CRTLCCNQSTP---------------------------------------
A0A2D1LYW3_BHRF1-0      CRRLCCNQSTP---------------------------------------
A0A0C7TTN2_BHRF1-0      CRTLCCNQSTP---------------------------------------
A0A0C7TQI4_BHRF1-0      CRTLCCNQYTP---------------------------------------
A0A2H4Z4I0_BHRF1-0      CRTLCCNQSTP---------------------------------------
A0A0C7TNT4_BHRF1-0      CRTLCCNQSTP---------------------------------------
A0A0C7TK05_BHRF1-0      CRTLCCNPSTP---------------------------------------
A0A0C7T924_BHRF1-0      CRTLCCNQSTP---------------------------------------
A0A0C7T306_BHRF1-0      CRTLCCNQSTP---------------------------------------
A0A0C7SXB3_BHRF1-0      CRTLCFNQSTP---------------------------------------
A0A2H4Z4C5_BHRF1-0      CRTLCCNQSTP---------------------------------------
A0A2S1MW70_BHRF1-0      CRTLCCNQSTP---------------------------------------
A0A0B6VHG4_BHRF1-0      CRTLCCNQYTP---------------------------------------
A0A0X9C4Q9_BHRF1-0      CRTLCCNQSTP---------------------------------------
A0A2H4Z4I4_BHRF1-0      CRTLCCNQSTP---------------------------------------
A0A2H4Z4M5_BHRF1-0      CRTLCCNQSTP---------------------------------------
A0A2S1N164_BHRF1-0      CRTLCCNQSTP---------------------------------------
G3CKQ0_BHRF1-01         CRTLCCNQSTP---------------------------------------
A0A2H4Z4D6_BHRF1-0      CRTLCCNQYTP---------------------------------------
A0A2S1N3G0_BHRF1-0      CRTLCCNQSTP---------------------------------------
V5KUE2_BHRF1-02         CRTLCCNQSTP---------------------------------------
A0A385JAL1_BHRF1-0      CRTLCCNQSTP---------------------------------------
A0A0S2YRE8_BHRF1-0      CRTLCCNQSTP---------------------------------------
V5KU29_BHRF1-02         CRTLCCNQSTP---------------------------------------
A0A0C7T6R4_BHRF1-0      CRTLCCNQSTP---------------------------------------
A0A0C7TX82_BHRF1-0      CRTLCCNQSTP---------------------------------------
A0A0X8YIW3_BHRF1-0      CRALCCNQSTP---------------------------------------
A0A2H4Z4F8_BHRF1-0      CRTLCCNQSTP---------------------------------------
A0A2S1MMY2_BHRF1-0      CRTLCCNQSTP---------------------------------------
P0C6Z1_BHRF1-01         CRTLCCNQSTP---------------------------------------
P03182_BHRF1-01         CRTLCCNQSTP---------------------------------------
K9UTN7_BHRF1-01         CRTLCCNQSTP---------------------------------------
A0A385J9R2_BHRF1-0      CRTLCCNQSTP---------------------------------------
K9UTF7_BHRF1-01         CRTLCCNQSTP---------------------------------------
P89884_M11-01           ------------------VYRADYGPALKNWKRDLSKLFTSLFVDVINSG
B1PZP0_M11-01           ------------------VYRADYGPALKNWKRDLSKLFTSLFVDVINSG
D0U1R1_M11-01           ------------------VFHMDYGPALQNWKGGLARLFTSLFGDAINRG
A0A385JAB4_BALF1-0      CRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVL------------
A0A2S1N1Z2_BALF1-0      CRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVL------------
A0A2S1N2H2_BALF1-0      CRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVL------------
A0A2S1MZQ8_BALF1-0      CRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVL------------
A0A385J7X7_BALF1-0      CRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVL------------
A0A2S1MXY9_BALF1-0      CRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVL------------
A0A2S1MU91_BALF1-0      CRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVL------------
A0A2S1MQV1_BALF1-0      CRTADVGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVL------------
A0A0U3UKR9_BALF1-0      CRTADIRGKDTHVRLIISVLRAVYNDHYDYWSRLRVVL------------
A0A0U3U737_BALF1-0      CRTADIGDKDTHVRLIISVLRAVYNDHYDYWSRLRVVL------------
A0A0S2YQW9_BALF1-0      CRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVL------------
A0A2S1MV59_BALF1-0      CRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVL------------
A0A2S1MM94_BALF1-0      CRTADIGGKDTHVRLIISVLRALYNDHYDYWSRLRVVL------------
A0A2S1MP06_BALF1-0      CRTADIGGKDTHVRIIISVLRAVYNDHYDYWSRLRVVL------------
A0A2S1MTH2_BALF1-0      CRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVL------------
A0A385J8K7_BALF1-0      CRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVL------------
U5YUM6_BALF1-01         CRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVL------------
Q91HV2_BALF1-01         CRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVL------------
P0CK59_BALF1-01         CRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVL------------
A0A385JB67_BALF1-0      CRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVL------------
P0CK58_BALF1-01         CRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVL------------
A0A0C7TV67_BALF1-0      CRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVL------------
A0A0C7TUX3_BALF1-0      CRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVL------------
A0A0C7TPI3_BALF1-0      CRTADVGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVL------------
A0A0C7TLW1_BALF1-0      CRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVL------------
A0A075FFB0_BALF1-0      CRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVL------------
A0A075FCZ0_BALF1-0      CRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVL------------
A0A0C7T8J1_BALF1-0      CRTADIGGKDTHVRIIISVLRAVYNDHYDYWSRLRVVL------------
A0A0C7TJ32_BALF1-0      CRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVL------------
A0A2D1LYV4_BALF1-0      CRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVL------------
K9UT94_BALF1-01         CRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVL------------
Q99F65_BALF1-01         CKTADIGGRHAHVQLITSVLRAVYDDHCDYWSRLRVVL------------
Q99F66_BALF1-01         CKTADIGGKHAHVQLIISILRAVYDDHYDYWSRLRVVL------------
Q91HI3_BALF1-01         CKTADIGGKHAHVQLIISVLRAVYDDHYDYWSRLRVVL------------
P90504_ORF16-01         MLANVRFHSTTGINQLGLSMLQVSGDGNMNWGRALAIL------------
F5HGJ3_ORF16-01         MLANVRFHSTTGINQLGLSMLQVSGDGNMNWGRALAIL------------
Q76RI8_ORF16-01         MLANVRFHSTTGINQLGLSMLQVSGDGNMNWGRALAIL------------
H3ALX7_vNR13-01         CGPEAELG-----SVLKRVAEQLEAEGGLNWGRVVSLF------------
Q90343_vNR13-01         CAPLARAEPREAAALLRKVAAQLETDGGLNWGRLLALV------------
Q9E1F2_vNR13-01         CAPLASGGTQAALSALQSVVSELNSGSGFNWGRCLATI------------
Q9E1F2_vNR13-02         CAPLASGGTQAALSALQSVVSELNSGSGFNWGRCLATI------------
                                                                          

Q1XBS6_VBCL2-01         -----------RCCLDIFTRATVQALNV----------------------
Q1XBS8_VBCL2-01         -----------RCCLDIFTRATVQALNV----------------------
Q1XBS7_VBCL2-01         -----------RCCLDIFTRATVQALNV----------------------
Q99D15_VBCL2-01         -----------RCCLDIFTRATVQALNV----------------------
Q9WH78_VBCL2-01         -----------RCCLDIFTRATVQALNV----------------------
A1BM64_A9-01            -----------YLQISSTQKVFFRDHYKKIESIIEAHIV-----------
Q2VSG7_A9-01            -----------YLQISSTQKVFFRDHYKKIESIIEAHIV-----------
A0A1L2JVL1_A9-01        -----------AYLQKNSTEKL----------------------------
O36423_A9-01            -----------AYLQKNSTEKL----------------------------
Q9Q5K8_BHRF1-01         -----------YYVVDLAVRGMLEASEGLD--------------------
Q9WGB5_BHRF1-01         -----------YYVVDLAVRGMLEASEGLD--------------------
Q9IHR2_BHRF1-01         -----------YYVVDLSVRGMLEASEGLD--------------------
A0A0S2YQS0_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
A0A2H4Z4F2_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
A0A385J922_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
A0A385J8Q6_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
A0A385J7D0_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
A0A2S1N3U3_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
A0A2S1MYK7_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
A0A2S1MX38_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
A0A2S1MWX4_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
A0A2S1MNB9_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
A0A2H4Z4H8_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
A0A2H4Z4E3_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
A0A2H4Z4D9_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
A0A0C7U1E2_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
A0A0C7TWM2_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
A0A2D1LYW3_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
A0A0C7TTN2_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
A0A0C7TQI4_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
A0A2H4Z4I0_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
A0A0C7TNT4_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
A0A0C7TK05_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
A0A0C7T924_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
A0A0C7T306_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
A0A0C7SXB3_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
A0A2H4Z4C5_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
A0A2S1MW70_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
A0A0B6VHG4_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
A0A0X9C4Q9_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
A0A2H4Z4I4_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
A0A2H4Z4M5_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
A0A2S1N164_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
G3CKQ0_BHRF1-01         -----------YYVVDLSVRGMLEASEGLD--------------------
A0A2H4Z4D6_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
A0A2S1N3G0_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
V5KUE2_BHRF1-02         -----------YYVVDLSVRGMLEASEGLD--------------------
A0A385JAL1_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
A0A0S2YRE8_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
V5KU29_BHRF1-02         -----------YYVVDLSVRGMLEASEGLD--------------------
A0A0C7T6R4_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
A0A0C7TX82_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
A0A0X8YIW3_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
A0A2H4Z4F8_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
A0A2S1MMY2_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
P0C6Z1_BHRF1-01         -----------YYVVDLSVRGMLEASEGLD--------------------
P03182_BHRF1-01         -----------YYVVDLSVRGMLEASEGLD--------------------
K9UTN7_BHRF1-01         -----------YYVVDLSVRGMLEASEGLD--------------------
A0A385J9R2_BHRF1-0      -----------YYVVDLSVRGMLEASEGLD--------------------
K9UTF7_BHRF1-01         -----------YYVVDLSVRGMLEASEGLD--------------------
P89884_M11-01           RIVGFFDVGRYVCEEVLCPGSWTEDHELLNDCMTHFFIENNLMNHFPLED
B1PZP0_M11-01           RIVGFFDVGRYVCEEVLCPGSWTEDHELLNDCMTHFFIENNLMNHFPLED
D0U1R1_M11-01           RIVGFFDVGRYVCEELLCPGSWTEEHDLLNEYMTQFFIENNLMNYFSLED
A0A385JAB4_BALF1-0      -----------CYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A2S1N1Z2_BALF1-0      -----------CYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A2S1N2H2_BALF1-0      -----------CYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A2S1MZQ8_BALF1-0      -----------CYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A385J7X7_BALF1-0      -----------CYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A2S1MXY9_BALF1-0      -----------CYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A2S1MU91_BALF1-0      -----------CYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A2S1MQV1_BALF1-0      -----------CYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A0U3UKR9_BALF1-0      -----------CYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A0U3U737_BALF1-0      -----------CYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A0S2YQW9_BALF1-0      -----------CYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A2S1MV59_BALF1-0      -----------CYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A2S1MM94_BALF1-0      -----------CYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A2S1MP06_BALF1-0      -----------CYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A2S1MTH2_BALF1-0      -----------CYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A385J8K7_BALF1-0      -----------CYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
U5YUM6_BALF1-01         -----------CYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
Q91HV2_BALF1-01         -----------CYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
P0CK59_BALF1-01         -----------CYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A385JB67_BALF1-0      -----------CYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
P0CK58_BALF1-01         -----------CYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A0C7TV67_BALF1-0      -----------CYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A0C7TUX3_BALF1-0      -----------CYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A0C7TPI3_BALF1-0      -----------CYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A0C7TLW1_BALF1-0      -----------CYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A075FFB0_BALF1-0      -----------CYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A075FCZ0_BALF1-0      -----------CYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A0C7T8J1_BALF1-0      -----------CYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A0C7TJ32_BALF1-0      -----------CYTVVFAVRNYLNDHKSA------AFVLGAIAHYLALYR
A0A2D1LYV4_BALF1-0      -----------CYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
K9UT94_BALF1-01         -----------CYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
Q99F65_BALF1-01         -----------CYTVVFAVRNYLDDHRSA------AFVLGAIAHYLALYR
Q99F66_BALF1-01         -----------CYAVVFAVRNYLDDHESA------AFVLGATAHYLALYR
Q91HI3_BALF1-01         -----------CYTVVFAVRNYLDDHESA------AFVLGAIAHYLALYR
P90504_ORF16-01         -----------TFGSFVAQKLSNEPHLR-------DFALAVLPVYAYEAI
F5HGJ3_ORF16-01         -----------TFGSFVAQKLSNEPHLR-------DFALAVLPVYAYEAI
Q76RI8_ORF16-01         -----------TFGSFVAQKLSNEPHLR-------DFALAVLPVYAYEAI
H3ALX7_vNR13-01         -----------AFAGCLAKGVQRAQNEECAMGACCGKLAEALVNYLAKER
Q90343_vNR13-01         -----------VFAGTLAAALAESACEEGP-----SRLAAALTAYLAEEQ
Q9E1F2_vNR13-01         -----------VLGGSLATALYENGCEEGP-----SRLAAALAAYLAEEQ
Q9E1F2_vNR13-02         -----------VLGGSLATALYENGCEEGP-----SRLAAALAAYLAEEQ
                                                                          

Q1XBS6_VBCL2-01         --NWFLQEGGWPALAS------FCKVVNSPSPRSRWL------FPMLAIS
Q1XBS8_VBCL2-01         --NWFLQEGGWPALAS------FCKVVNSPSPRSRWL------FPMLAIS
Q1XBS7_VBCL2-01         --NWFLQEGGWPALAS------FCKVVNSPSPRSRWL------FPMLAIS
Q99D15_VBCL2-01         --NWFLQEGGWPALAS------FCKVVNSPSPRSRWL------FPMFAIS
Q9WH78_VBCL2-01         --NWFLQEGGWPALAS------FCKVVNSPSPRSRWL------FPMFAIS
A1BM64_A9-01            --PWTLSQRKLKEPFP---------------------------LKMREVV
Q2VSG7_A9-01            --PWTLSQRKLKEPFP---------------------------LKMREVV
A0A1L2JVL1_A9-01        --FWNDHLKKLKQIVKCHIVPWTLGPRDPKPKQRPFDKLPSAFYFLTAAA
O36423_A9-01            --FWNDHLKKLKQIVKCHIVPWTLGPRDPKPKQRPFDKLPSAFYFLTAAA
Q9Q5K8_BHRF1-01         --GWIGQHGGWPAVLR---------GNPSGTRSSRWT------IVFTGLT
Q9WGB5_BHRF1-01         --GWIGQHGGWPAVLR---------GNPSGTRSSRWT------IVFTGLT
Q9IHR2_BHRF1-01         --AWIHQQGGWTGLIR---------SDSLGSTNSRWT------LLFAGLT
A0A0S2YQS0_BHRF1-0      --GWIHQQGGWSTLIE---------DNIPGSRSFSWT------LFLAGLT
A0A2H4Z4F2_BHRF1-0      --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
A0A385J922_BHRF1-0      --GWIHQQGGWSTLIE---------DNIPGSRSFSWT------LFLAGLT
A0A385J8Q6_BHRF1-0      --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
A0A385J7D0_BHRF1-0      --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
A0A2S1N3U3_BHRF1-0      --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
A0A2S1MYK7_BHRF1-0      --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
A0A2S1MX38_BHRF1-0      --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
A0A2S1MWX4_BHRF1-0      --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
A0A2S1MNB9_BHRF1-0      --GWIHQQGGWSTLIE---------DNIPGYRRFSWT------LFLAGLT
A0A2H4Z4H8_BHRF1-0      --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
A0A2H4Z4E3_BHRF1-0      --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
A0A2H4Z4D9_BHRF1-0      --GWIHQQGGWSTLIE---------DNIPGSRRFIWT------LFLAGLT
A0A0C7U1E2_BHRF1-0      --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
A0A0C7TWM2_BHRF1-0      --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
A0A2D1LYW3_BHRF1-0      --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
A0A0C7TTN2_BHRF1-0      --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
A0A0C7TQI4_BHRF1-0      --GWIHQQGGWSTLIE---------NNIPGSRRFSWT------LFLAGLT
A0A2H4Z4I0_BHRF1-0      --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
A0A0C7TNT4_BHRF1-0      --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
A0A0C7TK05_BHRF1-0      --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
A0A0C7T924_BHRF1-0      --GWIHQQGGWSTLIE---------DNIPGSRKFSWT------LFLAGLT
A0A0C7T306_BHRF1-0      --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
A0A0C7SXB3_BHRF1-0      --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
A0A2H4Z4C5_BHRF1-0      --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
A0A2S1MW70_BHRF1-0      --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
A0A0B6VHG4_BHRF1-0      --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
A0A0X9C4Q9_BHRF1-0      --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
A0A2H4Z4I4_BHRF1-0      --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
A0A2H4Z4M5_BHRF1-0      --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
A0A2S1N164_BHRF1-0      --GWIHQQGGWSTLIE---------DNFPGSRRFSWT------LFLAGLT
G3CKQ0_BHRF1-01         --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
A0A2H4Z4D6_BHRF1-0      --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
A0A2S1N3G0_BHRF1-0      --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
V5KUE2_BHRF1-02         --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
A0A385JAL1_BHRF1-0      --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
A0A0S2YRE8_BHRF1-0      --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
V5KU29_BHRF1-02         --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
A0A0C7T6R4_BHRF1-0      --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
A0A0C7TX82_BHRF1-0      --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
A0A0X8YIW3_BHRF1-0      --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
A0A2H4Z4F8_BHRF1-0      --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
A0A2S1MMY2_BHRF1-0      --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
P0C6Z1_BHRF1-01         --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
P03182_BHRF1-01         --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
K9UTN7_BHRF1-01         --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
A0A385J9R2_BHRF1-0      --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
K9UTF7_BHRF1-01         --GWIHQQGGWSTLIE---------DNIPGSRRFSWT------LFLAGLT
P89884_M11-01           IFLAQRKF-----------------------QTTGFT------FLLHALA
B1PZP0_M11-01           IFLAQRKF-----------------------QTTGFT------FLLHALA
D0U1R1_M11-01           TFCTQTKF-----------------------HNMGFS------LALSILC
A0A385JAB4_BALF1-0      R-LWFARLGGMPRSLR---------------RQFPVT------WALASLT
A0A2S1N1Z2_BALF1-0      R-LWFARLGGMPRSLR---------------RQFPVT------WALASLT
A0A2S1N2H2_BALF1-0      R-LWFARLGGMPRSLR---------------RQFPVT------WALASLT
A0A2S1MZQ8_BALF1-0      R-LWFARLGGMPRSLR---------------RQFPVT------WALASLT
A0A385J7X7_BALF1-0      R-LWFARLGGMPRSLR---------------RQFPVT------WALASLT
A0A2S1MXY9_BALF1-0      R-PWFARLGGMPRSLR---------------RQFPVT------WALASLT
A0A2S1MU91_BALF1-0      R-LWFARLGGMPRSLR---------------RQFPVT------WALASLT
A0A2S1MQV1_BALF1-0      R-LWFARLGGMPRSLR---------------RQFPVT------WALASLT
A0A0U3UKR9_BALF1-0      R-LWFARLGGMPRSLR---------------RQFPVT------WALASLT
A0A0U3U737_BALF1-0      R-LWFARLGGMPRSLR---------------RQFPVT------WALASLT
A0A0S2YQW9_BALF1-0      R-LWFARLGGMPRSLR---------------RQFPVT------WALASLT
A0A2S1MV59_BALF1-0      R-LWFARLGGMPRSLR---------------RQFPVT------WALASLT
A0A2S1MM94_BALF1-0      R-LWFARLGGMPRSLR---------------RQFPVT------WALASLT
A0A2S1MP06_BALF1-0      R-LWFARLGGMPRSLR---------------RQFPVT------WALASLT
A0A2S1MTH2_BALF1-0      R-LWFARLGGMPRSLR---------------RQFPVT------WALASLT
A0A385J8K7_BALF1-0      R-LWFARLGGMPRSLR---------------RQFPVT------WALASLT
U5YUM6_BALF1-01         R-LWFARLGGMPRSLR---------------RQFPVT------WALASLT
Q91HV2_BALF1-01         R-LWFARLGGMPRSLR---------------CQFPVT------WALASLT
P0CK59_BALF1-01         R-LWFARLGGMPRSLR---------------RQFPVT------WALASLT
A0A385JB67_BALF1-0      R-LWFARLGGMPRSLR---------------RQFPVT------WALASLT
P0CK58_BALF1-01         R-LWFARLGGMPRSLR---------------RQFPVT------WALASLT
A0A0C7TV67_BALF1-0      R-IWFARLGGMPRSLR---------------RQFPVT------WALASLT
A0A0C7TUX3_BALF1-0      R-LWFARLGGMPRSLR---------------RQFPVT------WALASLT
A0A0C7TPI3_BALF1-0      R-LWFARLGGMPRSLR---------------RQFPVT------WALASLT
A0A0C7TLW1_BALF1-0      R-LWFARLGGMPRSLR---------------RQFPVT------WALASLT
A0A075FFB0_BALF1-0      R-LWFARLGGMPRSLR---------------RQFPVT------WALASLT
A0A075FCZ0_BALF1-0      R-LWFARLGGMPRSLK---------------RQFPVT------WALASLT
A0A0C7T8J1_BALF1-0      R-LWFARLGGMPRSLR---------------RQFPVT------WALASLT
A0A0C7TJ32_BALF1-0      R-LWFARLGGMPRSLR---------------RQFPVT------WALASLT
A0A2D1LYV4_BALF1-0      R-LWFARLGGMPRSLR---------------CQFPVT------WALASLT
K9UT94_BALF1-01         R-LWFARLGGMPRSLR---------------RQFPVT------WALASLT
Q99F65_BALF1-01         R-LWFARMGGMPRSLR---------------RQFPVT------WAMAGLT
Q99F66_BALF1-01         R-VWFARIGGLPRSLR---------------RQFPVT------WAIASLS
Q91HI3_BALF1-01         R-LWFARMGGMPRSLR---------------RQFPVR------WALAGLT
P90504_ORF16-01         GPQWFRARGGWRGLKA------YCTQVLTRRRGRRMT------ALLGSIA
F5HGJ3_ORF16-01         GPQWFRARGGWRGLKA------YCTQVLTRRRGRRMT------ALLGSIA
Q76RI8_ORF16-01         GPQWFRARGGWRGLKA------YCTQVLTRRRGRRMT------ALLGSIA
H3ALX7_vNR13-01         G-DWLEENGGWDGFYK--FFERSDH---YQESTVRNA------L-MAAAG
Q90343_vNR13-01         G-EWMEEHGGWDGFCR--FFGRHGSQPADQNSTLSNA------I-MAAAG
Q9E1F2_vNR13-01         G-EWLREHGGWDGFCR--FFARFGPGLGEASQTFPLG------LIVAAAG
Q9E1F2_vNR13-02         G-EWLREHGGWVSTARAGMSGSFGSPVSARSEEHRAR------R------
                                                                          

Q1XBS6_VBCL2-01         GLVLTVGVARNMVHFT-----
Q1XBS8_VBCL2-01         GLVLTVGVARNMVHFT-----
Q1XBS7_VBCL2-01         GLVLTVGVARNMVHFT-----
Q99D15_VBCL2-01         GLVLTVGVARNMVHFT-----
Q9WH78_VBCL2-01         GLVLTVGVARNMVHFT-----
A1BM64_A9-01            IFFTTVASLVAMLLFCRRAWS
Q2VSG7_A9-01            IFFTTVASLVAMLLLCRRAWG
A0A1L2JVL1_A9-01        SCLTLLLL----YFRTTQTK-
O36423_A9-01            SCLTLLLL----YFRTTQTK-
Q9Q5K8_BHRF1-01         LSLLVVCS----YIFISR-RH
Q9WGB5_BHRF1-01         LSLLVVCS----YIFISR-RH
Q9IHR2_BHRF1-01         LSLLIVCS----YLFISRGRH
A0A0S2YQS0_BHRF1-0      LSLLVVCS----YLFISRGRH
A0A2H4Z4F2_BHRF1-0      LSLLVICS----YLFISRGRH
A0A385J922_BHRF1-0      LSLLVICS----YLFISRGRH
A0A385J8Q6_BHRF1-0      LSLLVICS----YLFISRGRH
A0A385J7D0_BHRF1-0      LSLLVICS----YLFISRGRH
A0A2S1N3U3_BHRF1-0      LSLLVICS----YLFISRGRH
A0A2S1MYK7_BHRF1-0      LSLLVICS----YLFISRGRH
A0A2S1MX38_BHRF1-0      LSLLVICS----YLFISRGRH
A0A2S1MWX4_BHRF1-0      LSLLVICS----YLFISRGRH
A0A2S1MNB9_BHRF1-0      LSLLVICS----YLFISRGRH
A0A2H4Z4H8_BHRF1-0      LSLLVICS----YLFISRGRH
A0A2H4Z4E3_BHRF1-0      LSLLVICS----YLFISRGRH
A0A2H4Z4D9_BHRF1-0      LSLLVICS----YLFISRGRH
A0A0C7U1E2_BHRF1-0      LSLLVICS----YLFISRGRH
A0A0C7TWM2_BHRF1-0      LSLLVICS----YLFISRGRH
A0A2D1LYW3_BHRF1-0      LSLLVICS----YLFISRGRH
A0A0C7TTN2_BHRF1-0      LSLLVICS----YLFISRGRH
A0A0C7TQI4_BHRF1-0      LSLLVICS----YLFISRGRH
A0A2H4Z4I0_BHRF1-0      LSLLVICS----YLFISRGRH
A0A0C7TNT4_BHRF1-0      LSLLVICS----YLFISRGRH
A0A0C7TK05_BHRF1-0      LSLLVICS----YLFISRGRH
A0A0C7T924_BHRF1-0      LSLLVICS----YLFISRGRH
A0A0C7T306_BHRF1-0      LSLLVICS----YLFISRGRH
A0A0C7SXB3_BHRF1-0      LSLLVICS----YLFISRGRH
A0A2H4Z4C5_BHRF1-0      LSLLVICS----YLFISRGRH
A0A2S1MW70_BHRF1-0      LSLLVICS----YLFISRGRH
A0A0B6VHG4_BHRF1-0      LSLLVICS----YLFISRGRH
A0A0X9C4Q9_BHRF1-0      LSLLVICS----YLFISRGRH
A0A2H4Z4I4_BHRF1-0      LSLLVICS----YLFISRGRH
A0A2H4Z4M5_BHRF1-0      LSLLVICS----YLFISRGRH
A0A2S1N164_BHRF1-0      LSLLVICS----YLFISRGRH
G3CKQ0_BHRF1-01         LSLLVICS----YLFISRGRH
A0A2H4Z4D6_BHRF1-0      LSLLVICS----YLFISRGRH
A0A2S1N3G0_BHRF1-0      LSLLVICS----YLFISRGRQ
V5KUE2_BHRF1-02         LSLLVICS----YLFISRGRH
A0A385JAL1_BHRF1-0      LSLLVICS----YLFISRGRH
A0A0S2YRE8_BHRF1-0      LSLLVICS----YLFISRGRH
V5KU29_BHRF1-02         LSLLVICS----YLFISRGRQ
A0A0C7T6R4_BHRF1-0      LSLLVICS----YLFISRGRH
A0A0C7TX82_BHRF1-0      LSLLVICS----YLFISRGRH
A0A0X8YIW3_BHRF1-0      LSLLVICS----YLFISRGRH
A0A2H4Z4F8_BHRF1-0      LSLLVICS----YLFISRGRH
A0A2S1MMY2_BHRF1-0      LSLLVICS----YLFISRGRH
P0C6Z1_BHRF1-01         LSLLVICS----YLFISRGRH
P03182_BHRF1-01         LSLLVICS----YLFISRGRH
K9UTN7_BHRF1-01         LSLLVICS----YLFISRGRH
A0A385J9R2_BHRF1-0      LSLLVICS----YLFISRGRH
K9UTF7_BHRF1-01         LSLLVICS----YLFISRGRH
P89884_M11-01           KVLPRIYS----GNVIYV---
B1PZP0_M11-01           KVLPRIYS----GNVIYV---
D0U1R1_M11-01           RALTRIYS----GDVIYV---
A0A385JAB4_BALF1-0      DFLKSL---------------
A0A2S1N1Z2_BALF1-0      DFLKSL---------------
A0A2S1N2H2_BALF1-0      DFLKSL---------------
A0A2S1MZQ8_BALF1-0      DFLKSL---------------
A0A385J7X7_BALF1-0      DFLKSL---------------
A0A2S1MXY9_BALF1-0      DFLKSL---------------
A0A2S1MU91_BALF1-0      DFLKSL---------------
A0A2S1MQV1_BALF1-0      DFLKSL---------------
A0A0U3UKR9_BALF1-0      DFLKSL---------------
A0A0U3U737_BALF1-0      DFLKSL---------------
A0A0S2YQW9_BALF1-0      DFLKSL---------------
A0A2S1MV59_BALF1-0      DFLKSL---------------
A0A2S1MM94_BALF1-0      DFLKSL---------------
A0A2S1MP06_BALF1-0      DFLKSL---------------
A0A2S1MTH2_BALF1-0      DFLKSL---------------
A0A385J8K7_BALF1-0      DFLKSL---------------
U5YUM6_BALF1-01         DFLKSL---------------
Q91HV2_BALF1-01         DFLKSL---------------
P0CK59_BALF1-01         DFLKSL---------------
A0A385JB67_BALF1-0      DFLKSL---------------
P0CK58_BALF1-01         DFLKSL---------------
A0A0C7TV67_BALF1-0      DFLKSL---------------
A0A0C7TUX3_BALF1-0      DFLKSL---------------
A0A0C7TPI3_BALF1-0      DFLKSL---------------
A0A0C7TLW1_BALF1-0      DFLKSL---------------
A0A075FFB0_BALF1-0      DFLKSL---------------
A0A075FCZ0_BALF1-0      DFLKSL---------------
A0A0C7T8J1_BALF1-0      DFLKSL---------------
A0A0C7TJ32_BALF1-0      DFLKSL---------------
A0A2D1LYV4_BALF1-0      DFLKSL---------------
K9UT94_BALF1-01         DFLKSL---------------
Q99F65_BALF1-01         DFLKSL---------------
Q99F66_BALF1-01         DFLKSL---------------
Q91HI3_BALF1-01         YFLKSL---------------
P90504_ORF16-01         LLATILAA----VAMSRR---
F5HGJ3_ORF16-01         LLATILAA----VAMSRR---
Q76RI8_ORF16-01         LLATILAA----VAMSRR---
H3ALX7_vNR13-01         FGIAGLAF----LLAVR----
Q90343_vNR13-01         FGIAGLAF----LLVVR----
Q9E1F2_vNR13-01         IGITVLIV----VWQFQS---
Q9E1F2_vNR13-02         -------------W-------
                                             

© 1998-2019