Dataset for protein herpesviridae of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

139 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q1XBS6_VBCL2-01         ----------------MSLFFVVWYWVNYITKVCSGEVYIPSVLKFQYHS
Q1XBS8_VBCL2-01         ----------------MSLFFIVWYWVNYITKVCSGEVYIPSVLKFQYHS
Q1XBS7_VBCL2-01         ----------------MSLFFVVWYWVNYITKVCSGEVYIPSVLKFQYHS
Q99D15_VBCL2-01         ----------------MSLFFVVWYWVNYITKVCFGEVYIPSVLKFQYHS
Q9WH78_VBCL2-01         ----------------MSLFFVVWYWVNYITKVCSGEVYIPSVLKFQYHS
A1BM64_A9-01            ------------------MVEAGILSRKVTTGSHWTFFTPQTLKKGACLW
Q2VSG7_A9-01            ------------------MVEAGILSRKVTTGSHWTFFTPQTLKKGACLW
A0A1L2JVL1_A9-01        -----------------------------------MKMLGEPEFKENILY
O36423_A9-01            -----------------------------------MKMLGEPEFKENILY
Q9Q5K8_BHRF1-01         ------------------------------------------------MA
Q9WGB5_BHRF1-01         ------------------------------------------------MA
Q8UZJ4_BHRF1-01         ------------------------------------------------MA
Q9IHR2_BHRF1-01         ------------------------------------------------MA
A0A0S2YQS0_BHRF1-0      ------------------------------------------------MA
A0A2H4Z4F2_BHRF1-0      ------------------------------------------------MA
A0A4D6TV66_BHRF1-0      ------------------------------------------------MA
A0A4D6R3D4_BHRF1-0      ------------------------------------------------MA
A0A4D6QS84_BHRF1-0      ------------------------------------------------MA
A0A451G617_BHRF1-0      ------------------------------------------------MA
A0A410IGR6_BHRF1-0      ------------------------------------------------MA
A0A3R5U6U7_BHRF1-0      ------------------------------------------------MA
A0A3R5TSC7_BHRF1-0      ------------------------------------------------MA
A0A385J922_BHRF1-0      ------------------------------------------------MA
A0A385J8Q6_BHRF1-0      ------------------------------------------------MA
A0A385J7D0_BHRF1-0      ------------------------------------------------MA
A0A2S1N3U3_BHRF1-0      ------------------------------------------------MA
A0A2S1MYK7_BHRF1-0      ------------------------------------------------MA
A0A2S1MX38_BHRF1-0      ------------------------------------------------MA
A0A2S1MWX4_BHRF1-0      ------------------------------------------------MA
A0A2S1MNB9_BHRF1-0      ------------------------------------------------MA
A0A2H4Z4I0_BHRF1-0      ------------------------------------------------MA
A0A3R5X5H4_BHRF1-0      ------------------------------------------------MA
A0A2H4Z4H8_BHRF1-0      ------------------------------------------------MA
A0A0C7U1E2_BHRF1-0      ------------------------------------------------MA
A0A0C7TNT4_BHRF1-0      ------------------------------------------------MA
A0A0C7TK05_BHRF1-0      ------------------------------------------------MA
A0A0C7T924_BHRF1-0      ------------------------------------------------MA
A0A0C7T306_BHRF1-0      ------------------------------------------------MA
A0A0C7SXB3_BHRF1-0      ------------------------------------------------MA
A0A451G5Y6_BHRF1-0      ------------------------------------------------MA
A0A410I865_BHRF1-0      ------------------------------------------------MA
A0A2H4Z4C5_BHRF1-0      ------------------------------------------------MA
A0A2S1MW70_BHRF1-0      ------------------------------------------------MA
A0A0B6VHG4_BHRF1-0      ------------------------------------------------MA
A0A0X9C4Q9_BHRF1-0      ------------------------------------------------MA
A0A2H4Z4I4_BHRF1-0      ------------------------------------------------MA
A0A2H4Z4M5_BHRF1-0      ------------------------------------------------MA
A0A3R5UEL7_BHRF1-0      ------------------------------------------------MA
A0A4D6QZG6_BHRF1-0      ------------------------------------------------MA
A0A4D6R7N0_BHRF1-0      ------------------------------------------------MA
A0A2S1N164_BHRF1-0      ------------------------------------------------MA
A0A2H4Z4D6_BHRF1-0      ------------------------------------------------MA
A0A2S1N3G0_BHRF1-0      ------------------------------------------------MA
V5KUE2_BHRF1-02         ------------------------------------------------MA
A0A2D1LYW3_BHRF1-0      ------------------------------------------------MA
A0A0C7TWM2_BHRF1-0      ------------------------------------------------MA
A0A385JAL1_BHRF1-0      ------------------------------------------------MA
A0A2H4Z4E3_BHRF1-0      ------------------------------------------------MA
A0A2H4Z4D9_BHRF1-0      ------------------------------------------------MA
A0A0S2YRE8_BHRF1-0      ------------------------------------------------MA
V5KU29_BHRF1-02         ------------------------------------------------MA
A0A0C7TX82_BHRF1-0      ------------------------------------------------MA
A0A0X8YIW3_BHRF1-0      ------------------------------------------------MA
A0A2H4Z4F8_BHRF1-0      ------------------------------------------------MA
A0A2S1MMY2_BHRF1-0      ------------------------------------------------MA
K9UTN7_BHRF1-01         ------------------------------------------------MA
A0A0C7T6R4_BHRF1-0      ------------------------------------------------MA
P03182_BHRF1-01         ------------------------------------------------MA
K9UTF7_BHRF1-01         ------------------------------------------------MA
A0A4D6TWZ3_BHRF1-0      ------------------------------------------------MA
A0A4D6QKL8_BHRF1-0      ------------------------------------------------MA
A0A385J9R2_BHRF1-0      ------------------------------------------------MA
A0A3R5TRD4_BHRF1-0      ------------------------------------------------MA
A0A385JAB4_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDAVFV
A0A2S1N2H2_BALF1-0      MNRAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1N1Z2_BALF1-0      MNRAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MZQ8_BALF1-0      MNLAITLDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A385J7X7_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MXY9_BALF1-0      MNLAIALDFPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MU91_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MQV1_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A0U3U737_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A0S2YQW9_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRQAKSTDSVFV
A0A2S1MV59_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A0A8IKW4_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MM94_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MP06_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MTH2_BALF1-0      MNLAIALDSHHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A385J8K7_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A0U3UKR9_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVNWPDETMRPAKSTDSVFV
U5YUM6_BALF1-01         MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
P0CK59_BALF1-01         MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
Q91HV2_BALF1-01         MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A385JB67_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
P0CK58_BALF1-01         MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A4D6RBY3_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A4D6QMD2_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A410J0D8_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A0C7TLW1_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A4D6RC31_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A4D6QXN1_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A410I9N0_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A410I1F1_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A3R5WKR1_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A0C7TUX3_BALF1-0      --------------------------------------MRQAKSTDSVFV
A0A0C7TPI3_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A0C7T5J4_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A0C7TV67_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A075FFB0_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A075FCZ0_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A0C7T546_BALF1-0      --------------------------------------MRPAKCTDSVFV
A0A0C7T8J1_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A0C7TJ32_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A1P7TZL6_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A3R5WNA2_BALF1-0      --------------------------------------MRPAKTTDSVFV
A0A3R5WV36_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A3R5WYW3_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A3R5ZJV6_BALF1-0      --------------------------------------MRPTKSTDSVFV
A0A4D6QN24_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A4D6R4T3_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A4D6R8R0_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A4D6RE52_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A4D6RFR1_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A4D6TWI9_BALF1-0      --------------------------------------MRPAKSTDSVFV
K9UT94_BALF1-01         --------------------------------------MRPAKSTDSVFV
A0A2D1LYV4_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A4D6R8J3_BALF1-0      --------------------------------------MKPAKSTDSVFV
Q99F65_BALF1-01         --------------------------------------MRPAESTDSVFV
Q99F66_BALF1-01         --------------------------------------MKAAKSTDSVFV
Q91HI3_BALF1-01         --------------------------------------MRPAKSTDSVFV
P89884_M11-01           --------------------------------------------------
B1PZP0_M11-01           --------------------------------------------------
D0U1R1_M11-01           --------------------------------------------------
P90504_ORF16-01         --------------------------------------------------
F5HGJ3_ORF16-01         --------------------------------------------------
Q76RI8_ORF16-01         --------------------------------------------------
H3ALX7_vNR13-01         --------------------------------------------------
Q90343_vNR13-01         --------------------------------------------------
Q9DH00_vNR13-01         --------------------------------------------------
                                                                          

Q1XBS6_VBCL2-01         DTEHEPYSNLCENLITMAEQDMDEVVSTIRRLLVECGMGLEEYLDHPVTA
Q1XBS8_VBCL2-01         DTEHEPYSNLCENLITMAEQDMDEVVSTIRRLLVECGMGLEEYLDHPVTA
Q1XBS7_VBCL2-01         DTEHEPYSNLCENLITMAEQDMDEVVSTIRRLLVECGMGLEEYLEHPVTA
Q99D15_VBCL2-01         DTEHEPYSNLCKNLITMAEQDMDEVVSTIRRLLVECGMGLEEYLEHPVTA
Q9WH78_VBCL2-01         DTEHEPYSNLCKNLITMAEQDMDEVVSTIRRLLVECGMGLEEYLEHPVTA
A1BM64_A9-01            KAGAVYFPPASMP----PRKAFNDGDLL----YFNFTREIHMLLIKSGI-
Q2VSG7_A9-01            KAGAVYFPPVSMP----PRKAFNDGDLL----YFNFTREIHMLLIKSGI-
A0A1L2JVL1_A9-01        YSFLNELFLILIR----NGFSCSHAKL-----------------------
O36423_A9-01            YSFLNELFLILIR----NGFSCSHAKL-----------------------
Q9Q5K8_BHRF1-01         YSTRDLLLALCMR----DGHVYGGDGLHPVLELTARESPFSVSPGDPLVL
Q9WGB5_BHRF1-01         YSTRDLLLALCMR----DGHVYGGDGLHPVLELTARESPFSVSPGDPLVL
Q8UZJ4_BHRF1-01         FSTRDLLLALCMR----DSHVHGNEGLHPVLELASRESPSSLSAGDTLVL
Q9IHR2_BHRF1-01         YSTRDILLALCMR----DSYVHGNGSLHPVLELAARETPPRVSPEDTVVL
A0A0S2YQS0_BHRF1-0      HSTREILLALCIR----DSRVHGNGVLHPVLELAARETPPRVSPEDTVVL
A0A2H4Z4F2_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLRLSPEDTVVL
A0A4D6TV66_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETRLCLSPEDTVVL
A0A4D6R3D4_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLRLSPEDTVVL
A0A4D6QS84_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLRLSPEDTVVL
A0A451G617_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLRLSPEDTVVL
A0A410IGR6_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLHLSPEDTVVL
A0A3R5U6U7_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLRLSPEDTVVL
A0A3R5TSC7_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLRLSPEDTVVL
A0A385J922_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLRLSPEDTVVL
A0A385J8Q6_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLCLSPEDTVVL
A0A385J7D0_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETLLRLSPEDTVVL
A0A2S1N3U3_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELATRETPLRLSPEDTVVL
A0A2S1MYK7_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLCLSPEDTVVL
A0A2S1MX38_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLRLSPEDTVVL
A0A2S1MWX4_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLRLSPEDTVVL
A0A2S1MNB9_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLRLSPEDTVVL
A0A2H4Z4I0_BHRF1-0      YSTRDILLALCIR----DSRVHGNGALHPVLELAARETPPRLSPEDTVVL
A0A3R5X5H4_BHRF1-0      YSTRDILLALCIR----DSRVHGNGALHPVLELAARETPPRLSPEDTVVL
A0A2H4Z4H8_BHRF1-0      YSTREILLALCIR----DSRVHGNASLHPVLELAARETPLRLSPEDTVVL
A0A0C7U1E2_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELASRETPLRLSPEDTVVL
A0A0C7TNT4_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLRLSPEDTVVL
A0A0C7TK05_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLRLSPEDTVVL
A0A0C7T924_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLRLSPEDTVVL
A0A0C7T306_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETHLRLSPEDTVVL
A0A0C7SXB3_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLRLSPEDTVVL
A0A451G5Y6_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLRLSPEDTVVL
A0A410I865_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLRLSPEDTVVL
A0A2H4Z4C5_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLRLSPEDTVVL
A0A2S1MW70_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLRLSPEDTVVL
A0A0B6VHG4_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLRLSPEDTVVL
A0A0X9C4Q9_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLRLSPEDTVVL
A0A2H4Z4I4_BHRF1-0      YSTREILLALCIR----DSRVHGNGSLHPVLELAARETPLRLSPEDTVVL
A0A2H4Z4M5_BHRF1-0      YSTREILLALCIR----DSRVHGNGSLHPVLELAARETPLRLSPEDTVVL
A0A3R5UEL7_BHRF1-0      YSTREILLALCIR----DSRVHGNGALHPVLELAARETPPRLSPEDTIVL
A0A4D6QZG6_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLRLSPEDTVVL
A0A4D6R7N0_BHRF1-0      YSTREILLALCIR----DSRVHGNGPLHPVLELAARETPLRLSPEDTVVL
A0A2S1N164_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLRLSPEDTVVL
A0A2H4Z4D6_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLRLSPEDTVVL
A0A2S1N3G0_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELASRETPLRLSPEDTVVL
V5KUE2_BHRF1-02         YSTREILLALCIR----DSRVHGNGTLHPVLELASRETPLRLSPEDTVVL
A0A2D1LYW3_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLRLLPEDTVVL
A0A0C7TWM2_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLRLLPEDTVVL
A0A385JAL1_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLRLSPEDTVVL
A0A2H4Z4E3_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLRLSPEDTVVL
A0A2H4Z4D9_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLRLSPEDTVVL
A0A0S2YRE8_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLRLSPEDTVVL
V5KU29_BHRF1-02         YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLRLSPEDTVVL
A0A0C7TX82_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLRLSPEDTVVL
A0A0X8YIW3_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLRLSPEDTVVL
A0A2H4Z4F8_BHRF1-0      YSTREILLALCIR----DSRVHGNGILHPVLELAARETPLRLSPEDTVVL
A0A2S1MMY2_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARESPLRLSPEDTVVL
K9UTN7_BHRF1-01         YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLRLSPEDTVVL
A0A0C7T6R4_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLRLSPEDTVVL
P03182_BHRF1-01         YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLRLSPEDTVVL
K9UTF7_BHRF1-01         YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLRLSPEDTVVL
A0A4D6TWZ3_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLRLSPEDTVVL
A0A4D6QKL8_BHRF1-0      YSTREILLALCTR----DSRVHGNGTLHPVLELAARETPLRLSPEDTVVL
A0A385J9R2_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLRLSPEDTVVL
A0A3R5TRD4_BHRF1-0      YSTREILLALCIR----DSRVHGNGTLHPVLELAARETPLRLSPEDTVVL
A0A385JAB4_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
A0A2S1N2H2_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFARDEKDLPLPALV-
A0A2S1N1Z2_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFARDEKDLPLPALV-
A0A2S1MZQ8_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFARDEKDLPLPALV-
A0A385J7X7_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFARDEKDLPLPALV-
A0A2S1MXY9_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
A0A2S1MU91_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
A0A2S1MQV1_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
A0A0U3U737_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
A0A0S2YQW9_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
A0A2S1MV59_BALF1-0      RTPVEAWVAPLPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
A0A0A8IKW4_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
A0A2S1MM94_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
A0A2S1MP06_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
A0A2S1MTH2_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
A0A385J8K7_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKNLPLPALV-
A0A0U3UKR9_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
U5YUM6_BALF1-01         KTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
P0CK59_BALF1-01         RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
Q91HV2_BALF1-01         RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
A0A385JB67_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
P0CK58_BALF1-01         RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
A0A4D6RBY3_BALF1-0      RTPVDAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
A0A4D6QMD2_BALF1-0      RTPVEAWVAPSPP----DNKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
A0A410J0D8_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
A0A0C7TLW1_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
A0A4D6RC31_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
A0A4D6QXN1_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
A0A410I9N0_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
A0A410I1F1_BALF1-0      KTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
A0A3R5WKR1_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDETDLPLPALV-
A0A0C7TUX3_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
A0A0C7TPI3_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
A0A0C7T5J4_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFARDEKDLPLPALV-
A0A0C7TV67_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFARDEKDLPLPALV-
A0A075FFB0_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
A0A075FCZ0_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
A0A0C7T546_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
A0A0C7T8J1_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
A0A0C7TJ32_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
A0A1P7TZL6_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
A0A3R5WNA2_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
A0A3R5WV36_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
A0A3R5WYW3_BALF1-0      RTPVEAWVAPSPP----DDRVAESSYLMFRAMYAVFTRDEKDLPLPALV-
A0A3R5ZJV6_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
A0A4D6QN24_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
A0A4D6R4T3_BALF1-0      RTPVEAWIAPSTP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
A0A4D6R8R0_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
A0A4D6RE52_BALF1-0      RTPVEAWVAPSSP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
A0A4D6RFR1_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
A0A4D6TWI9_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
K9UT94_BALF1-01         RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
A0A2D1LYV4_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
A0A4D6R8J3_BALF1-0      RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTRDEKDLPLPALV-
Q99F65_BALF1-01         RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFSRDESDLPLPAAV-
Q99F66_BALF1-01         RTPVEAWVSPSPP----DDKVAETSYLLFRAMYAVFTQDETDLPTPAQV-
Q91HI3_BALF1-01         RTPVEAWVAPSPP----DDKVAESSYLMFRAMYAVFTQDETGLPLPAMV-
P89884_M11-01           -------MSHKKS----GTYWATLITAFLKTVSKVEELDCVDSAVLVDVS
B1PZP0_M11-01           -------MSHKKS----GTYWATLITAFLKTVSKVEELDCVDSAVLVDVS
D0U1R1_M11-01           -------MSHKRT----GTYWATIITAFLKSVSKVEELDCYDSDVLDDVS
P90504_ORF16-01         ------------M----DEDVLPGEVLAIEGIFMACGLNEPEYLYHPLLS
F5HGJ3_ORF16-01         ------------M----DEDVLPGEVLAIEGIFMACGLNEPEYLYHPLLS
Q76RI8_ORF16-01         ------------M----DEDVLPGEVLAIEGIFMACGLNEPEYLYHPLLS
H3ALX7_vNR13-01         ------------M----CDSLKEETRLLANDFIQFC-LGSGRTAPNPAAR
Q90343_vNR13-01         ------------M----PGSLKEETALLLEDYFQHR-AGGAALPPSATAA
Q9DH00_vNR13-01         ------------M----ADSLKEETALLLEDYFQHC-CGKEGPPPSPTAA
                                                                          

Q1XBS6_VBCL2-01         PIKVAVQDVIRTKQDIFSNFL--TNINSVEDLET----LGHAITTLNDYP
Q1XBS8_VBCL2-01         PIKVAVQDVIRTKQDIFSNFL--TNINSVEDLET----LGHAITTLNDYP
Q1XBS7_VBCL2-01         PIKVAVQDVIRTKQDIFSNFL--TNINSVEDLET----LGHAITTLNDYP
Q99D15_VBCL2-01         PIKVAVQDVIRTKQDIFSNFL--TNINSVEDLET----LGHAITTLNDYP
Q9WH78_VBCL2-01         PIKVAVQDVIRTKQDIFSNFL--TNINSVEDLET----LGHAITTLNDYP
A1BM64_A9-01            -PCSYAKGIMRAARTKAVDCSS-TFEVIVDGVGHPSPESLERIAKSLFTP
Q2VSG7_A9-01            -PCSYAKGIMRAARTKAVDCSS-TFEVIVDGVGHPSPESLERIAKSLFTP
A0A1L2JVL1_A9-01        ----ILDETRKRGLECSGQFEVISNSVEAPEPESLERIAKTLFTP-----
O36423_A9-01            ----ILDETRKRGLECSGQFEVISNSVEAPEPESLERIAKTLFTP-----
Q9Q5K8_BHRF1-01         RLHALLEQIIVQNEDAFAE----TLVTFLLNTEDLDLDFSRVFAEIFHNE
Q9WGB5_BHRF1-01         RLHALLEQIIVQNEDAFAE----TLDRFLLNTEDLDLDFSRVFAEIFHNE
Q8UZJ4_BHRF1-01         RVHVLLEQIIEQNAGAFLE----ALDRFLSNTEEWDVDFTRVFQEIFHRG
Q9IHR2_BHRF1-01         RLHLLLEEVIQQNAESFTN----TWETFITNAEHVDLDFAAVFEDIFHRG
A0A0S2YQS0_BHRF1-0      RYHVLLEEIIERNSDTFTE----TWDRFITHTEHLDLDFNSIFLEIFHRG
A0A2H4Z4F2_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTEHLDLDFNSVFLEIFHRG
A0A4D6TV66_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTEHVDLDFNSVFLEIFHRG
A0A4D6R3D4_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFIRHTEHLDLDFNSVFVEIFHRG
A0A4D6QS84_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTEHLDLDFNSVFLEIFHRG
A0A451G617_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTEHLDLDFNSVFLEIFHRG
A0A410IGR6_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTEHLDLDFNSVFLEIFHRG
A0A3R5U6U7_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFMTHTEHLDLDFNSVFLEIFHRG
A0A3R5TSC7_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTEHLDLDFNSVFLEIFHRG
A0A385J922_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTEHVDLDFNSVFVEIFHRG
A0A385J8Q6_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTEHVDLDFNSVFLEIFHRG
A0A385J7D0_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTEHVDLDFNSVFLEIFHRG
A0A2S1N3U3_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTEHVDLDFNSVFLEIFHRG
A0A2S1MYK7_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTEHLDLDFNSVFLEIFHRG
A0A2S1MX38_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFLTHTEHLDLDFNSVFLEIFHRG
A0A2S1MWX4_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFTTHTEHLDLDFNSVFLEIFHRG
A0A2S1MNB9_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTEHVDLDFNSVFLEIFHRG
A0A2H4Z4I0_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTEHLDLDFNSVFLEIFHRG
A0A3R5X5H4_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTENLDLDFNSVFLEIFHRG
A0A2H4Z4H8_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTEHLDLDFNSVFLEIFHRG
A0A0C7U1E2_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTEHVDLDFNSVFLEIFHRG
A0A0C7TNT4_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTEHVDLDFNSVFLEIFHRG
A0A0C7TK05_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTEHVDLDFNSVFLEIFHRG
A0A0C7T924_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTEHVDLDFNSVFLEIFHRG
A0A0C7T306_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTEHVDLDFNSVFLEIFHRG
A0A0C7SXB3_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTEHVDLDFNSVFLEIFHRG
A0A451G5Y6_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITYTEHLDLDFNSVFLEIFHRG
A0A410I865_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTEHMDLDFNSVFLEIFHRG
A0A2H4Z4C5_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTDHLDLDFNSVFLEIFHRG
A0A2S1MW70_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTGHLDLDFNSVFLEIFHRG
A0A0B6VHG4_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTENLDLDFNSVFLEIFHRG
A0A0X9C4Q9_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFIRHTEHLDLDFNSVFLEIFHRG
A0A2H4Z4I4_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTEHLDLDFNSVFLEIFHRG
A0A2H4Z4M5_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTEHLDLDFNSVFFEIFHRG
A0A3R5UEL7_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTENLDLDFNSVFLEIFHRG
A0A4D6QZG6_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTENLDLDFNSVFLEIFHRG
A0A4D6R7N0_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTEHLDLDFNSVFLEIFHRG
A0A2S1N164_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTEHLDLDFNSVFLEIFHRG
A0A2H4Z4D6_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTANLDLDFNSVFLEIFHRG
A0A2S1N3G0_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTEHVDLDFNSVFLEIFHRG
V5KUE2_BHRF1-02         RYHVLLEEIIERNSETFTE----TWNRFITHTEHVDLDFNSVFLEIFHRG
A0A2D1LYW3_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTEHVDLDFNSVFLEIFHRG
A0A0C7TWM2_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTEHVDLDFNSVFLEIFHRG
A0A385JAL1_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITYTEHVDLDFNSVFLEIFHRG
A0A2H4Z4E3_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNSFITHTEHVDLDFNSVFVEIFHRG
A0A2H4Z4D9_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTEHVDLDFNSVFVEIFHRG
A0A0S2YRE8_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTEHVDLDFNSVFLEIFHRG
V5KU29_BHRF1-02         RYHVLLEEIIERNSETFTE----TWNRFITHTEHVDLDFNSVFLEIFHRG
A0A0C7TX82_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTEHVDLDFNSVFLEIFHRG
A0A0X8YIW3_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTEHVDLDFNSVFLEIFHRG
A0A2H4Z4F8_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTEHVDLDFNSVFVEIFHRG
A0A2S1MMY2_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTEHVDLDFNSVFLEIFHRG
K9UTN7_BHRF1-01         RYHVLLEEIIERNSETFTE----TWNRFITHTEHVDLDFNSVFLEIFHRG
A0A0C7T6R4_BHRF1-0      RYHVLLEEIIERNSETFSE----TWNRFITHTEHVDLDFNSVFLEIFHRG
P03182_BHRF1-01         RYHVLLEEIIERNSETFTE----TWNRFITHTEHVDLDFNSVFLEIFHRG
K9UTF7_BHRF1-01         RYHVLLEEIIERNSETFTE----TWNRFITHTEHVDLDFNSVFVEIFHRG
A0A4D6TWZ3_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTEHVDLDFNSVFLEIFHRG
A0A4D6QKL8_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTEHVDLDFNSVFVEIFHRG
A0A385J9R2_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTEHVDLDFNSVFLEIFHRG
A0A3R5TRD4_BHRF1-0      RYHVLLEEIIERNSETFTE----TWNRFITHTEHVDLDFNSVFVEIFHRG
A0A385JAB4_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLRAVYNDH
A0A2S1N2H2_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLRAVYNDH
A0A2S1N1Z2_BALF1-0      -LCRLIKASLRKDRKLYTELA--CRTADIGGKDTHVRLIISVLRAVYNDH
A0A2S1MZQ8_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLRAVYNDH
A0A385J7X7_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLRAVYNDH
A0A2S1MXY9_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLRAVYNDH
A0A2S1MU91_BALF1-0      -LCRLIKASLRKDRELYAELA--CRTADIGGKDTHVRLIISVLRAVYNDH
A0A2S1MQV1_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADVGGKDTHVRLIISVLRAVYNDH
A0A0U3U737_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGDKDTHVRLIISVLRAVYNDH
A0A0S2YQW9_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLRAVYNDH
A0A2S1MV59_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLRAVYNDH
A0A0A8IKW4_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLRAVYNDH
A0A2S1MM94_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLRALYNDH
A0A2S1MP06_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRIIISVLRAVYNDH
A0A2S1MTH2_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLRAVYNDH
A0A385J8K7_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLRAVYNDH
A0A0U3UKR9_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIRGKDTHVRLIISVLRAVYNDH
U5YUM6_BALF1-01         -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLRAVYNDH
P0CK59_BALF1-01         -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLRAVYNDH
Q91HV2_BALF1-01         -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLRAVYNDH
A0A385JB67_BALF1-0      -LCRXXKAXLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLRAVYNDH
P0CK58_BALF1-01         -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLRAVYNDH
A0A4D6RBY3_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLRAVYNDH
A0A4D6QMD2_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLRAVYNDH
A0A410J0D8_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLRAVYNDH
A0A0C7TLW1_BALF1-0      -LCRLIKASLRKDRKLYADLA--CRTADIGGKDTHVRLIISVLRAVYNDH
A0A4D6RC31_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLRAVYNDH
A0A4D6QXN1_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVQLIISVLRAVYNDH
A0A410I9N0_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLRAVYNDH
A0A410I1F1_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLRAVYNDH
A0A3R5WKR1_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLRAVYNDH
A0A0C7TUX3_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLRAVYNDH
A0A0C7TPI3_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADVGGKDTHVRLIISVLRAVYNDH
A0A0C7T5J4_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLRAVYNDH
A0A0C7TV67_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLRAVYNDH
A0A075FFB0_BALF1-0      -LCRLIKASLRKDRRLYAELA--CRTADIGGKDTHVRLIISVLRAVYNDH
A0A075FCZ0_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLRAVYNDH
A0A0C7T546_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLRALYNDH
A0A0C7T8J1_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRIIISVLRAVYNDH
A0A0C7TJ32_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLRAVYNDH
A0A1P7TZL6_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLRAVYNDH
A0A3R5WNA2_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLRAVYNDH
A0A3R5WV36_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISILRAVYNDH
A0A3R5WYW3_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLRAVYNDH
A0A3R5ZJV6_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLRAVYNDH
A0A4D6QN24_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLRAVYNDH
A0A4D6R4T3_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLRAVYNDH
A0A4D6R8R0_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLRAVYNDH
A0A4D6RE52_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLRAVYNDH
A0A4D6RFR1_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLCAVYNDH
A0A4D6TWI9_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGGXDTHVRLIISVLRALYNDH
K9UT94_BALF1-01         -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLRAVYNDH
A0A2D1LYV4_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLRAVYNDH
A0A4D6R8J3_BALF1-0      -LCRLIKASLRKDRKLYAELA--CRTADIGGKDTHVRLIISVLRAVYNDH
Q99F65_BALF1-01         -LCRLIKASLKKDRKLYAELA--CKTADIGGRHAHVQLITSVLRAVYDDH
Q99F66_BALF1-01         -LCRLIKASLRKDKKLYAELA--CKTADIGGKHAHVQLIISILRAVYDDH
Q91HI3_BALF1-01         -LCRLIKASLKKDKKLYAELA--CKTADIGGKHAHVQLIISVLRAVYDDH
P89884_M11-01           KIITLTQEFRRHYDSVYRADYGPALKNWKRDLSKLFTSLFVDV-------
B1PZP0_M11-01           KIITLTQEFRRHYDSVYRADYGPALKNWKRDLSKLFTSLFVDV-------
D0U1R1_M11-01           KIITLTQEFRSHYDSVFHMDYGPALQNWKGGLARLFTSLFGDA-------
P90504_ORF16-01         PIKLYITGLMRDKESLFEA----MLANVRFHSTTGINQLGLSMLQVSGDG
F5HGJ3_ORF16-01         PIKLYITGLMRDKESLFEA----MLANVRFHSTTGINQLGLSMLQVSGDG
Q76RI8_ORF16-01         PIKLYITGLMRDKESLFEA----MLANVRFHSTTGINQLGLSMLQVSGDG
H3ALX7_vNR13-01         VLRRVTAELERQNQALFDSFQGNCGPEAELG-----SVLKRVAEQLEAEG
Q90343_vNR13-01         ELRRAAAELERRERPFFRS----CAPLARAEPREAAALLRKVAAQLETDG
Q9DH00_vNR13-01         ELRRAAAELERRERPFFRS----CAPLASGGTQAALSALQSVVSELNSGS
                                                                          

Q1XBS6_VBCL2-01         SPNMGRVVCGIAF-SVYVVQTVCKRKPLLV-----RCCLDIFTRATVQAL
Q1XBS8_VBCL2-01         SPNMGRVVCGIAF-SVYVVQTVCKRKPLLV-----RCCLDIFTRATVQAL
Q1XBS7_VBCL2-01         SPNMGRVVCGIAF-SVYVVQTVCKRKPLLV-----RCCLDIFTRATVQAL
Q99D15_VBCL2-01         SPNMGRVVCGIAF-SVYVVQTVCKRKPLLV-----RCCLDIFTRATVQAL
Q9WH78_VBCL2-01         SPNMGRVVCGIAF-SVYVVQTVCKRKPLLV-----RCCLDIFTRATVQAL
A1BM64_A9-01            RPNWGRVVMFFAYLFYLQISSTQK-----------VFFRDHYKKIESIIE
Q2VSG7_A9-01            RPNWGRVVMFFAYLFYLQISSTQK-----------VFFRDHYKKIESIIE
A0A1L2JVL1_A9-01        RPHWGRLVAFLAY-LAYLQKNSTEK----------LFWNDHLKKLKQIVK
O36423_A9-01            RPHWGRLVAFLAY-LAYLQKNSTEK----------LFWNDHLKKLKQIVK
Q9Q5K8_BHRF1-01         DPTLGRGLAWLAW-CMHACRTLCGDTNCP------YYVVDLAVRGMLEAS
Q9WGB5_BHRF1-01         DPTLGRGLAWLAW-CMHACRTLCGDTNCP------YYVVDLAVRGMLEAS
Q8UZJ4_BHRF1-01         NPTLGRALAWLAW-CMHACRTLCCNRNTP------YYVVDLSVRGMLEAS
Q9IHR2_BHRF1-01         DPSLGRALAWLAW-CMHACRTLCRNQNTP------YYVVDLSVRGMLEAS
A0A0S2YQS0_BHRF1-0      DPSRGRALAWLAW-CMHACRTLCCNQDTP------YYVVDLSVRGMLEAS
A0A2H4Z4F2_BHRF1-0      DPSLGCALTWMAW-GMHACWTLCCNQSTP------YYVVDLSVRGMLEAS
A0A4D6TV66_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A4D6R3D4_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A4D6QS84_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A451G617_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A410IGR6_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A3R5U6U7_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A3R5TSC7_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCSNQSTP------YYVVDLSVRGMLEAS
A0A385J922_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A385J8Q6_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A385J7D0_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A2S1N3U3_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A2S1MYK7_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A2S1MX38_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A2S1MWX4_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A2S1MNB9_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A2H4Z4I0_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A3R5X5H4_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A2H4Z4H8_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A0C7U1E2_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCYNQSTP------YYVVDLSVRGMLEAS
A0A0C7TNT4_BHRF1-0      DPSLGRTLAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A0C7TK05_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNPSTP------YYVVDLSVRGMLEAS
A0A0C7T924_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A0C7T306_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A0C7SXB3_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCFNQSTP------YYVVDLSVRGMLEAS
A0A451G5Y6_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A410I865_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A2H4Z4C5_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A2S1MW70_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A0B6VHG4_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQYTP------YYVVDLSVRGMLEAS
A0A0X9C4Q9_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A2H4Z4I4_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A2H4Z4M5_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A3R5UEL7_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQYTP------YYVVDLSVRGMLEAS
A0A4D6QZG6_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A4D6R7N0_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A2S1N164_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A2H4Z4D6_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQYTP------YYVVDLSVRGMLEAS
A0A2S1N3G0_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
V5KUE2_BHRF1-02         DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A2D1LYW3_BHRF1-0      DPSLGRALAWMAW-CMHACRRLCCNQSTP------YYVVDLSVRGMLEAS
A0A0C7TWM2_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A385JAL1_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A2H4Z4E3_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A2H4Z4D9_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A0S2YRE8_BHRF1-0      DPRLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
V5KU29_BHRF1-02         DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A0C7TX82_BHRF1-0      DPSLGRALAWMAW-CMYACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A0X8YIW3_BHRF1-0      DPSLGRALAWMAW-CMHACRALCCNQSTP------YYVVDLSVRGMLEAS
A0A2H4Z4F8_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A2S1MMY2_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
K9UTN7_BHRF1-01         DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A0C7T6R4_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
P03182_BHRF1-01         DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
K9UTF7_BHRF1-01         DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A4D6TWZ3_BHRF1-0      DPSLGRALAWMXW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A4D6QKL8_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A385J9R2_BHRF1-0      XPSLGRALAWMAW-CMHACRTLCCNQSTP------YYVVDLSVRGMLEAS
A0A3R5TRD4_BHRF1-0      DPSLGRALAWMAW-CMHACRTLCCNQCTP------YYVVDLSVRGMLEAS
A0A385JAB4_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A2S1N2H2_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A2S1N1Z2_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A2S1MZQ8_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A385J7X7_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A2S1MXY9_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A2S1MU91_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A2S1MQV1_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A0U3U737_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A0S2YQW9_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A2S1MV59_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A0A8IKW4_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A2S1MM94_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A2S1MP06_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A2S1MTH2_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A385J8K7_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A0U3UKR9_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
U5YUM6_BALF1-01         YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
P0CK59_BALF1-01         YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
Q91HV2_BALF1-01         YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A385JB67_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
P0CK58_BALF1-01         YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A4D6RBY3_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A4D6QMD2_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A410J0D8_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A0C7TLW1_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A4D6RC31_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A4D6QXN1_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A410I9N0_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A410I1F1_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A3R5WKR1_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A0C7TUX3_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A0C7TPI3_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A0C7T5J4_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A0C7TV67_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A075FFB0_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A075FCZ0_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A0C7T546_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A0C7T8J1_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A0C7TJ32_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLNDHKSA------AFVLGAIAHYLALYR
A0A1P7TZL6_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A3R5WNA2_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A3R5WV36_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A3R5WYW3_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A3R5ZJV6_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A4D6QN24_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A4D6R4T3_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A4D6R8R0_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLGDHKSA------AFVLGAIAHYLALYR
A0A4D6RE52_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A4D6RFR1_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A4D6TWI9_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
K9UT94_BALF1-01         YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A2D1LYV4_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
A0A4D6R8J3_BALF1-0      YDYWSRLRVVLCYTVVFAVRNYLDDHKSA------AFVLGAIAHYLALYR
Q99F65_BALF1-01         CDYWSRLRVVLCYTVVFAVRNYLDDHRSA------AFVLGAIAHYLALYR
Q99F66_BALF1-01         YDYWSRLRVVLCYAVVFAVRNYLDDHESA------AFVLGATAHYLALYR
Q91HI3_BALF1-01         YDYWSRLRVVLCYTVVFAVRNYLDDHESA------AFVLGAIAHYLALYR
P89884_M11-01           -INSGRIVGFFDVGRYVCEEVLCPGSWTEDH----ELLNDCMTHFFIENN
B1PZP0_M11-01           -INSGRIVGFFDVGRYVCEEVLCPGSWTEDH----ELLNDCMTHFFIENN
D0U1R1_M11-01           -INRGRIVGFFDVGRYVCEELLCPGSWTEEH----DLLNEYMTQFFIENN
P90504_ORF16-01         NMNWGRALAILTFGSFVAQKLSNEPHLR-------DFALAVLPVYAYEAI
F5HGJ3_ORF16-01         NMNWGRALAILTFGSFVAQKLSNEPHLR-------DFALAVLPVYAYEAI
Q76RI8_ORF16-01         NMNWGRALAILTFGSFVAQKLSNEPHLR-------DFALAVLPVYAYEAI
H3ALX7_vNR13-01         GLNWGRVVSLFAFAGCLAKGVQRAQNEECAMGACCGKLAEALVNYLAKER
Q90343_vNR13-01         GLNWGRLLALVVFAGTLAAALAESACEEGP-----SRLAAALTAYLAEEQ
Q9DH00_vNR13-01         GFNWGRCLATIVLGGSLATALYENGCEEGP-----SRLAAALAAYLAEEQ
                            .     .                                       

Q1XBS6_VBCL2-01         NVN--WFLQEGGW--PALASFCKVVNSPSPRSRWL---FPMLAISGLVLT
Q1XBS8_VBCL2-01         NVN--WFLQEGGW--PALASFCKVVNSPSPRSRWL---FPMLAISGLVLT
Q1XBS7_VBCL2-01         NVN--WFLQEGGW--PALASFCKVVNSPSPRSRWL---FPMLAISGLVLT
Q99D15_VBCL2-01         NVN--WFLQEGGW--PALASFCKVVNSPSPRSRWL---FPMFAISGLVLT
Q9WH78_VBCL2-01         NVN--WFLQEGGW--PALASFCKVVNSPSPRSRWL---FPMFAISGLVLT
A1BM64_A9-01            AHIVPWTLSQRKL------------KEPFPLKMR----EVVIFFTTVASL
Q2VSG7_A9-01            AHIVPWTLSQRKL------------KEPFPLKMR----EVVIFFTTVASL
A0A1L2JVL1_A9-01        CHIVPW---------------TLGPRDPKPKQRPFDKLPSAFYFLTAAAS
O36423_A9-01            CHIVPW---------------TLGPRDPKPKQRPFDKLPSAFYFLTAAAS
Q9Q5K8_BHRF1-01         EGLDGWIGQHGGW--------PAVLRGNPSGTRSS---RWTIVFTGLTLS
Q9WGB5_BHRF1-01         EGLDGWIGQHGGW--------PAVLRGNPSGTRSS---RWTIVFTGLTLS
Q8UZJ4_BHRF1-01         EGLDAWIHQQGGW--------PSLLRGNRSNTGSP---ILTAFLAGLTLT
Q9IHR2_BHRF1-01         EGLDAWIHQQGGW--------TGLIRSDSLGSTNS---RWTLLFAGLTLS
A0A0S2YQS0_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRSF---SWTLFLAGLTLS
A0A2H4Z4F2_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A4D6TV66_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A4D6R3D4_BHRF1-0      EGLDGWIHQQGSW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A4D6QS84_BHRF1-0      EGLDGWIHQQGGW--------STVIEDNIPGSRRF---SWTLFLAGLTLS
A0A451G617_BHRF1-0      EGLDGWIHQQGGW--------TTLIEDNIPGSRRF---SWTLFLAGLTLS
A0A410IGR6_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A3R5U6U7_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A3R5TSC7_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A385J922_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRSF---SWTLFLAGLTLS
A0A385J8Q6_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A385J7D0_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A2S1N3U3_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A2S1MYK7_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A2S1MX38_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A2S1MWX4_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A2S1MNB9_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGYRRF---SWTLFLAGLTLS
A0A2H4Z4I0_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A3R5X5H4_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A2H4Z4H8_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A0C7U1E2_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A0C7TNT4_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A0C7TK05_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A0C7T924_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRKF---SWTLFLAGLTLS
A0A0C7T306_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A0C7SXB3_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A451G5Y6_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A410I865_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A2H4Z4C5_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A2S1MW70_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A0B6VHG4_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A0X9C4Q9_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A2H4Z4I4_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A2H4Z4M5_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A3R5UEL7_BHRF1-0      EGLDGWIHQQGGW--------STLIENNIPGSRRF---SWTLFLAGLTLS
A0A4D6QZG6_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A4D6R7N0_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A2S1N164_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNFPGSRRF---SWTLFLAGLTLS
A0A2H4Z4D6_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A2S1N3G0_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
V5KUE2_BHRF1-02         EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A2D1LYW3_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A0C7TWM2_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A385JAL1_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A2H4Z4E3_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A2H4Z4D9_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---IWTLFLAGLTLS
A0A0S2YRE8_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
V5KU29_BHRF1-02         EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A0C7TX82_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A0X8YIW3_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A2H4Z4F8_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A2S1MMY2_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
K9UTN7_BHRF1-01         EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A0C7T6R4_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
P03182_BHRF1-01         EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
K9UTF7_BHRF1-01         EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A4D6TWZ3_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A4D6QKL8_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A385J9R2_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A3R5TRD4_BHRF1-0      EGLDGWIHQQGGW--------STLIEDNIPGSRRF---SWTLFLAGLTLS
A0A385JAB4_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A2S1N2H2_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A2S1N1Z2_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A2S1MZQ8_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A385J7X7_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A2S1MXY9_BALF1-0      R-P--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A2S1MU91_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A2S1MQV1_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A0U3U737_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A0S2YQW9_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A2S1MV59_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A0A8IKW4_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A2S1MM94_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A2S1MP06_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A2S1MTH2_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A385J8K7_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A0U3UKR9_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
U5YUM6_BALF1-01         R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
P0CK59_BALF1-01         R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
Q91HV2_BALF1-01         R-L--WFARLGGM--------------PRSLRCQF---PVTWALASLTDF
A0A385JB67_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
P0CK58_BALF1-01         R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A4D6RBY3_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A4D6QMD2_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A410J0D8_BALF1-0      R-L--WFVRLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A0C7TLW1_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A4D6RC31_BALF1-0      R-L--WFARLGGM--------------PRSLRRRF---PVTWALASLTDF
A0A4D6QXN1_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A410I9N0_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWTLASLTDF
A0A410I1F1_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A3R5WKR1_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A0C7TUX3_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A0C7TPI3_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A0C7T5J4_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A0C7TV67_BALF1-0      R-I--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A075FFB0_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A075FCZ0_BALF1-0      R-L--WFARLGGM--------------PRSLKRQF---PVTWALASLTDF
A0A0C7T546_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A0C7T8J1_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A0C7TJ32_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A1P7TZL6_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A3R5WNA2_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A3R5WV36_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A3R5WYW3_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A3R5ZJV6_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A4D6QN24_BALF1-0      R-L--WFARLGGM--------------PISLRRQF---PVTWALASLTDF
A0A4D6R4T3_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A4D6R8R0_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A4D6RE52_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A4D6RFR1_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A4D6TWI9_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
K9UT94_BALF1-01         R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
A0A2D1LYV4_BALF1-0      R-L--WFARLGGM--------------PRSLRCQF---PVTWALASLTDF
A0A4D6R8J3_BALF1-0      R-L--WFARLGGM--------------PRSLRRQF---PVTWALASLTDF
Q99F65_BALF1-01         R-L--WFARMGGM--------------PRSLRRQF---PVTWAMAGLTDF
Q99F66_BALF1-01         R-V--WFARIGGL--------------PRSLRRQF---PVTWAIASLSDF
Q91HI3_BALF1-01         R-L--WFARMGGM--------------PRSLRRQF---PVRWALAGLTYF
P89884_M11-01           LMN--HFPLEDIF-------------LAQRKFQTT---GFTFLLHALAKV
B1PZP0_M11-01           LMN--HFPLEDIF-------------LAQRKFQTT---GFTFLLHALAKV
D0U1R1_M11-01           LMN--YFSLEDTF-------------CTQTKFHNM---GFSLALSILCRA
P90504_ORF16-01         GPQ--WFRARGGW-----RGLKAYCTQVLTRRRGR---RMTALLGSIALL
F5HGJ3_ORF16-01         GPQ--WFRARGGW-----RGLKAYCTQVLTRRRGR---RMTALLGSIALL
Q76RI8_ORF16-01         GPQ--WFRARGGW-----RGLKAYCTQVLTRRRGR---RMTALLGSIALL
H3ALX7_vNR13-01         G-D--WLEENGGW-----DGFYKFFERSDHY---Q---ESTVRNALMAAA
Q90343_vNR13-01         G-E--WMEEHGGW-----DGFCRFFGRHGSQPADQ---NSTLSNAIMAAA
Q9DH00_vNR13-01         G-E--WLREHGGWVSTARAGMSGSFGSPVSARSEE---HRARRW------
                                                                          

Q1XBS6_VBCL2-01         VGVARNMVHFT----
Q1XBS8_VBCL2-01         VGVARNMVHFT----
Q1XBS7_VBCL2-01         VGVARNMVHFT----
Q99D15_VBCL2-01         VGVARNMVHFT----
Q9WH78_VBCL2-01         VGVARNMVHFT----
A1BM64_A9-01            VAML---LFCRRAWS
Q2VSG7_A9-01            VAML---LLCRRAWG
A0A1L2JVL1_A9-01        CLTLLLLYFRTTQTK
O36423_A9-01            CLTLLLLYFRTTQTK
Q9Q5K8_BHRF1-01         LLVVCSYIFISR-RH
Q9WGB5_BHRF1-01         LLVVCSYIFISR-RH
Q8UZJ4_BHRF1-01         FVVVCSYLFISGRRR
Q9IHR2_BHRF1-01         LLIVCSYLFISRGRH
A0A0S2YQS0_BHRF1-0      LLVVCSYLFISRGRH
A0A2H4Z4F2_BHRF1-0      LLVICSYLFISRGRH
A0A4D6TV66_BHRF1-0      LLVICSYLFISRGRH
A0A4D6R3D4_BHRF1-0      LLVICSYLFISRGRH
A0A4D6QS84_BHRF1-0      LLVICSYLFISRGRH
A0A451G617_BHRF1-0      LLVICSYLFISRGRH
A0A410IGR6_BHRF1-0      LLVICSYLFISRGRH
A0A3R5U6U7_BHRF1-0      LLVICSYLFISRGRH
A0A3R5TSC7_BHRF1-0      LLVICSYLFISRGRH
A0A385J922_BHRF1-0      LLVICSYLFISRGRH
A0A385J8Q6_BHRF1-0      LLVICSYLFISRGRH
A0A385J7D0_BHRF1-0      LLVICSYLFISRGRH
A0A2S1N3U3_BHRF1-0      LLVICSYLFISRGRH
A0A2S1MYK7_BHRF1-0      LLVICSYLFISRGRH
A0A2S1MX38_BHRF1-0      LLVICSYLFISRGRH
A0A2S1MWX4_BHRF1-0      LLVICSYLFISRGRH
A0A2S1MNB9_BHRF1-0      LLVICSYLFISRGRH
A0A2H4Z4I0_BHRF1-0      LLVICSYLFISRGRH
A0A3R5X5H4_BHRF1-0      LLVICSYLFISRGRH
A0A2H4Z4H8_BHRF1-0      LLVICSYLFISRGRH
A0A0C7U1E2_BHRF1-0      LLVICSYLFISRGRH
A0A0C7TNT4_BHRF1-0      LLVICSYLFISRGRH
A0A0C7TK05_BHRF1-0      LLVICSYLFISRGRH
A0A0C7T924_BHRF1-0      LLVICSYLFISRGRH
A0A0C7T306_BHRF1-0      LLVICSYLFISRGRH
A0A0C7SXB3_BHRF1-0      LLVICSYLFISRGRH
A0A451G5Y6_BHRF1-0      LLVICSYLFISRGRH
A0A410I865_BHRF1-0      LLVICSYLFISRGRH
A0A2H4Z4C5_BHRF1-0      LLVICSYLFISRGRH
A0A2S1MW70_BHRF1-0      LLVICSYLFISRGRH
A0A0B6VHG4_BHRF1-0      LLVICSYLFISRGRH
A0A0X9C4Q9_BHRF1-0      LLVICSYLFISRGRH
A0A2H4Z4I4_BHRF1-0      LLVICSYLFISRGRH
A0A2H4Z4M5_BHRF1-0      LLVICSYLFISRGRH
A0A3R5UEL7_BHRF1-0      LLVICSYLFISRGRH
A0A4D6QZG6_BHRF1-0      LLVICSYLFISRGRH
A0A4D6R7N0_BHRF1-0      LLVICSYLFISRGRH
A0A2S1N164_BHRF1-0      LLVICSYLFISRGRH
A0A2H4Z4D6_BHRF1-0      LLVICSYLFISRGRH
A0A2S1N3G0_BHRF1-0      LLVICSYLFISRGRQ
V5KUE2_BHRF1-02         LLVICSYLFISRGRH
A0A2D1LYW3_BHRF1-0      LLVICSYLFISRGRH
A0A0C7TWM2_BHRF1-0      LLVICSYLFISRGRH
A0A385JAL1_BHRF1-0      LLVICSYLFISRGRH
A0A2H4Z4E3_BHRF1-0      LLVICSYLFISRGRH
A0A2H4Z4D9_BHRF1-0      LLVICSYLFISRGRH
A0A0S2YRE8_BHRF1-0      LLVICSYLFISRGRH
V5KU29_BHRF1-02         LLVICSYLFISRGRQ
A0A0C7TX82_BHRF1-0      LLVICSYLFISRGRH
A0A0X8YIW3_BHRF1-0      LLVICSYLFISRGRH
A0A2H4Z4F8_BHRF1-0      LLVICSYLFISRGRH
A0A2S1MMY2_BHRF1-0      LLVICSYLFISRGRH
K9UTN7_BHRF1-01         LLVICSYLFISRGRH
A0A0C7T6R4_BHRF1-0      LLVICSYLFISRGRH
P03182_BHRF1-01         LLVICSYLFISRGRH
K9UTF7_BHRF1-01         LLVICSYLFISRGRH
A0A4D6TWZ3_BHRF1-0      LLVICSYLFISRGRH
A0A4D6QKL8_BHRF1-0      LLVICSYLFISRGRH
A0A385J9R2_BHRF1-0      LLVICSYLFISRGRH
A0A3R5TRD4_BHRF1-0      LLVICSYLFISRGRH
A0A385JAB4_BALF1-0      LKSL-----------
A0A2S1N2H2_BALF1-0      LKSL-----------
A0A2S1N1Z2_BALF1-0      LKSL-----------
A0A2S1MZQ8_BALF1-0      LKSL-----------
A0A385J7X7_BALF1-0      LKSL-----------
A0A2S1MXY9_BALF1-0      LKSL-----------
A0A2S1MU91_BALF1-0      LKSL-----------
A0A2S1MQV1_BALF1-0      LKSL-----------
A0A0U3U737_BALF1-0      LKSL-----------
A0A0S2YQW9_BALF1-0      LKSL-----------
A0A2S1MV59_BALF1-0      LKSL-----------
A0A0A8IKW4_BALF1-0      LKSL-----------
A0A2S1MM94_BALF1-0      LKSL-----------
A0A2S1MP06_BALF1-0      LKSL-----------
A0A2S1MTH2_BALF1-0      LKSL-----------
A0A385J8K7_BALF1-0      LKSL-----------
A0A0U3UKR9_BALF1-0      LKSL-----------
U5YUM6_BALF1-01         LKSL-----------
P0CK59_BALF1-01         LKSL-----------
Q91HV2_BALF1-01         LKSL-----------
A0A385JB67_BALF1-0      LKSL-----------
P0CK58_BALF1-01         LKSL-----------
A0A4D6RBY3_BALF1-0      LKSL-----------
A0A4D6QMD2_BALF1-0      LKSL-----------
A0A410J0D8_BALF1-0      LKSL-----------
A0A0C7TLW1_BALF1-0      LKSL-----------
A0A4D6RC31_BALF1-0      LKSL-----------
A0A4D6QXN1_BALF1-0      LKSL-----------
A0A410I9N0_BALF1-0      LKSL-----------
A0A410I1F1_BALF1-0      LKSL-----------
A0A3R5WKR1_BALF1-0      LKSL-----------
A0A0C7TUX3_BALF1-0      LKSL-----------
A0A0C7TPI3_BALF1-0      LKSL-----------
A0A0C7T5J4_BALF1-0      LKSL-----------
A0A0C7TV67_BALF1-0      LKSL-----------
A0A075FFB0_BALF1-0      LKSL-----------
A0A075FCZ0_BALF1-0      LKSL-----------
A0A0C7T546_BALF1-0      LKSL-----------
A0A0C7T8J1_BALF1-0      LKSL-----------
A0A0C7TJ32_BALF1-0      LKSL-----------
A0A1P7TZL6_BALF1-0      LKSL-----------
A0A3R5WNA2_BALF1-0      LKSL-----------
A0A3R5WV36_BALF1-0      LKSL-----------
A0A3R5WYW3_BALF1-0      LKSL-----------
A0A3R5ZJV6_BALF1-0      LKSL-----------
A0A4D6QN24_BALF1-0      LKSL-----------
A0A4D6R4T3_BALF1-0      LKSL-----------
A0A4D6R8R0_BALF1-0      LKSL-----------
A0A4D6RE52_BALF1-0      LKSL-----------
A0A4D6RFR1_BALF1-0      LKSL-----------
A0A4D6TWI9_BALF1-0      LKSL-----------
K9UT94_BALF1-01         LKSL-----------
A0A2D1LYV4_BALF1-0      LKSL-----------
A0A4D6R8J3_BALF1-0      LKSL-----------
Q99F65_BALF1-01         LKSL-----------
Q99F66_BALF1-01         LKSL-----------
Q91HI3_BALF1-01         LKSL-----------
P89884_M11-01           LPRIYSGNVIYV---
B1PZP0_M11-01           LPRIYSGNVIYV---
D0U1R1_M11-01           LTRIYSGDVIYV---
P90504_ORF16-01         ATILAAVAMSRR---
F5HGJ3_ORF16-01         ATILAAVAMSRR---
Q76RI8_ORF16-01         ATILAAVAMSRR---
H3ALX7_vNR13-01         GFGIAGLAFLLAVR-
Q90343_vNR13-01         GFGIAGLAFLLVVR-
Q9DH00_vNR13-01         ---------------
                                       

© 1998-2019