Dataset for protein BALF1 of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

45 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A385JAB4_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDAVFV
A0A2S1N1Z2_BALF1-0      MNRAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1N2H2_BALF1-0      MNRAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MZQ8_BALF1-0      MNLAITLDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A385J7X7_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MXY9_BALF1-0      MNLAIALDFPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MU91_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MQV1_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A0U3UKR9_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVNWPDETMRPAKSTDSVFV
A0A0U3U737_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A0S2YQW9_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRQAKSTDSVFV
A0A2S1MV59_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A0A8IKW4_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MM94_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MP06_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MTH2_BALF1-0      MNLAIALDSHHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A385J8K7_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
U5YUM6_BALF1-01         MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
Q91HV2_BALF1-01         MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
P0CK59_BALF1-01         MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A385JB67_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
P0CK58_BALF1-01         MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A410J0D8_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A410I9N0_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A410I1F1_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A3R5WKR1_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A0C7TUX3_BALF1-0      --------------------------------------MRQAKSTDSVFV
A0A0C7TPI3_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A0C7TLW1_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A0C7T5J4_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A0C7TV67_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A075FFB0_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A075FCZ0_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A0C7T546_BALF1-0      --------------------------------------MRPAKCTDSVFV
A0A0C7T8J1_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A0C7TJ32_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A2D1LYV4_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A3R5WNA2_BALF1-0      --------------------------------------MRPAKTTDSVFV
A0A3R5WV36_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A3R5WYW3_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A3R5ZJV6_BALF1-0      --------------------------------------MRPTKSTDSVFV
K9UT94_BALF1-01         --------------------------------------MRPAKSTDSVFV
Q99F65_BALF1-01         --------------------------------------MRPAESTDSVFV
Q99F66_BALF1-01         --------------------------------------MKAAKSTDSVFV
Q91HI3_BALF1-01         --------------------------------------MRPAKSTDSVFV
                                                              *. :: **:***

A0A385JAB4_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
A0A2S1N1Z2_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFARDEKDLPLPALVLCRLI
A0A2S1N2H2_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFARDEKDLPLPALVLCRLI
A0A2S1MZQ8_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFARDEKDLPLPALVLCRLI
A0A385J7X7_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFARDEKDLPLPALVLCRLI
A0A2S1MXY9_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
A0A2S1MU91_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
A0A2S1MQV1_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
A0A0U3UKR9_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
A0A0U3U737_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
A0A0S2YQW9_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
A0A2S1MV59_BALF1-0      RTPVEAWVAPLPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
A0A0A8IKW4_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
A0A2S1MM94_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
A0A2S1MP06_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
A0A2S1MTH2_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
A0A385J8K7_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKNLPLPALVLCRLI
U5YUM6_BALF1-01         KTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
Q91HV2_BALF1-01         RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
P0CK59_BALF1-01         RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
A0A385JB67_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRXX
P0CK58_BALF1-01         RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
A0A410J0D8_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
A0A410I9N0_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
A0A410I1F1_BALF1-0      KTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
A0A3R5WKR1_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDETDLPLPALVLCRLI
A0A0C7TUX3_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
A0A0C7TPI3_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
A0A0C7TLW1_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
A0A0C7T5J4_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFARDEKDLPLPALVLCRLI
A0A0C7TV67_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFARDEKDLPLPALVLCRLI
A0A075FFB0_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
A0A075FCZ0_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
A0A0C7T546_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
A0A0C7T8J1_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
A0A0C7TJ32_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
A0A2D1LYV4_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
A0A3R5WNA2_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
A0A3R5WV36_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
A0A3R5WYW3_BALF1-0      RTPVEAWVAPSPPDDRVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
A0A3R5ZJV6_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
K9UT94_BALF1-01         RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
Q99F65_BALF1-01         RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFSRDESDLPLPAAVLCRLI
Q99F66_BALF1-01         RTPVEAWVSPSPPDDKVAETSYLLFRAMYAVFTQDETDLPTPAQVLCRLI
Q91HI3_BALF1-01         RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTQDETGLPLPAMVLCRLI
                        .*******:* ****.***:***:********:.**..** ** ****  

A0A385JAB4_BALF1-0      KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A2S1N1Z2_BALF1-0      KASLRKDRKLYTELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A2S1N2H2_BALF1-0      KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A2S1MZQ8_BALF1-0      KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A385J7X7_BALF1-0      KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A2S1MXY9_BALF1-0      KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A2S1MU91_BALF1-0      KASLRKDRELYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A2S1MQV1_BALF1-0      KASLRKDRKLYAELACRTADVGGKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A0U3UKR9_BALF1-0      KASLRKDRKLYAELACRTADIRGKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A0U3U737_BALF1-0      KASLRKDRKLYAELACRTADIGDKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A0S2YQW9_BALF1-0      KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A2S1MV59_BALF1-0      KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A0A8IKW4_BALF1-0      KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A2S1MM94_BALF1-0      KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRALYNDHYDYWSRLR
A0A2S1MP06_BALF1-0      KASLRKDRKLYAELACRTADIGGKDTHVRIIISVLRAVYNDHYDYWSRLR
A0A2S1MTH2_BALF1-0      KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A385J8K7_BALF1-0      KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
U5YUM6_BALF1-01         KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
Q91HV2_BALF1-01         KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
P0CK59_BALF1-01         KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A385JB67_BALF1-0      KAXLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
P0CK58_BALF1-01         KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A410J0D8_BALF1-0      KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A410I9N0_BALF1-0      KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A410I1F1_BALF1-0      KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A3R5WKR1_BALF1-0      KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A0C7TUX3_BALF1-0      KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A0C7TPI3_BALF1-0      KASLRKDRKLYAELACRTADVGGKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A0C7TLW1_BALF1-0      KASLRKDRKLYADLACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A0C7T5J4_BALF1-0      KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A0C7TV67_BALF1-0      KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A075FFB0_BALF1-0      KASLRKDRRLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A075FCZ0_BALF1-0      KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A0C7T546_BALF1-0      KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRALYNDHYDYWSRLR
A0A0C7T8J1_BALF1-0      KASLRKDRKLYAELACRTADIGGKDTHVRIIISVLRAVYNDHYDYWSRLR
A0A0C7TJ32_BALF1-0      KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A2D1LYV4_BALF1-0      KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A3R5WNA2_BALF1-0      KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A3R5WV36_BALF1-0      KASLRKDRKLYAELACRTADIGGKDTHVRLIISILRAVYNDHYDYWSRLR
A0A3R5WYW3_BALF1-0      KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A3R5ZJV6_BALF1-0      KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
K9UT94_BALF1-01         KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
Q99F65_BALF1-01         KASLKKDRKLYAELACKTADIGGRHAHVQLITSVLRAVYDDHCDYWSRLR
Q99F66_BALF1-01         KASLRKDKKLYAELACKTADIGGKHAHVQLIISILRAVYDDHYDYWSRLR
Q91HI3_BALF1-01         KASLKKDKKLYAELACKTADIGGKHAHVQLIISVLRAVYDDHYDYWSRLR
                        ** *.**. **::***.***: .. :**.:* *:***:*:** *******

A0A385JAB4_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A2S1N1Z2_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A2S1N2H2_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A2S1MZQ8_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A385J7X7_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A2S1MXY9_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRPWFARLGGMPRSL
A0A2S1MU91_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A2S1MQV1_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A0U3UKR9_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A0U3U737_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A0S2YQW9_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A2S1MV59_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A0A8IKW4_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A2S1MM94_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A2S1MP06_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A2S1MTH2_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A385J8K7_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
U5YUM6_BALF1-01         VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
Q91HV2_BALF1-01         VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
P0CK59_BALF1-01         VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A385JB67_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
P0CK58_BALF1-01         VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A410J0D8_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFVRLGGMPRSL
A0A410I9N0_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A410I1F1_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A3R5WKR1_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A0C7TUX3_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A0C7TPI3_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A0C7TLW1_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A0C7T5J4_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A0C7TV67_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRIWFARLGGMPRSL
A0A075FFB0_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A075FCZ0_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A0C7T546_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A0C7T8J1_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A0C7TJ32_BALF1-0      VVLCYTVVFAVRNYLNDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A2D1LYV4_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A3R5WNA2_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A3R5WV36_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A3R5WYW3_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A3R5ZJV6_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
K9UT94_BALF1-01         VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
Q99F65_BALF1-01         VVLCYTVVFAVRNYLDDHRSAAFVLGAIAHYLALYRRLWFARMGGMPRSL
Q99F66_BALF1-01         VVLCYAVVFAVRNYLDDHESAAFVLGATAHYLALYRRVWFARIGGLPRSL
Q91HI3_BALF1-01         VVLCYTVVFAVRNYLDDHESAAFVLGAIAHYLALYRRLWFARMGGMPRSL
                        *****:*********:** ******** ********* **.*:**:****

A0A385JAB4_BALF1-0      RRQFPVTWALASLTDFLKSL
A0A2S1N1Z2_BALF1-0      RRQFPVTWALASLTDFLKSL
A0A2S1N2H2_BALF1-0      RRQFPVTWALASLTDFLKSL
A0A2S1MZQ8_BALF1-0      RRQFPVTWALASLTDFLKSL
A0A385J7X7_BALF1-0      RRQFPVTWALASLTDFLKSL
A0A2S1MXY9_BALF1-0      RRQFPVTWALASLTDFLKSL
A0A2S1MU91_BALF1-0      RRQFPVTWALASLTDFLKSL
A0A2S1MQV1_BALF1-0      RRQFPVTWALASLTDFLKSL
A0A0U3UKR9_BALF1-0      RRQFPVTWALASLTDFLKSL
A0A0U3U737_BALF1-0      RRQFPVTWALASLTDFLKSL
A0A0S2YQW9_BALF1-0      RRQFPVTWALASLTDFLKSL
A0A2S1MV59_BALF1-0      RRQFPVTWALASLTDFLKSL
A0A0A8IKW4_BALF1-0      RRQFPVTWALASLTDFLKSL
A0A2S1MM94_BALF1-0      RRQFPVTWALASLTDFLKSL
A0A2S1MP06_BALF1-0      RRQFPVTWALASLTDFLKSL
A0A2S1MTH2_BALF1-0      RRQFPVTWALASLTDFLKSL
A0A385J8K7_BALF1-0      RRQFPVTWALASLTDFLKSL
U5YUM6_BALF1-01         RRQFPVTWALASLTDFLKSL
Q91HV2_BALF1-01         RCQFPVTWALASLTDFLKSL
P0CK59_BALF1-01         RRQFPVTWALASLTDFLKSL
A0A385JB67_BALF1-0      RRQFPVTWALASLTDFLKSL
P0CK58_BALF1-01         RRQFPVTWALASLTDFLKSL
A0A410J0D8_BALF1-0      RRQFPVTWALASLTDFLKSL
A0A410I9N0_BALF1-0      RRQFPVTWTLASLTDFLKSL
A0A410I1F1_BALF1-0      RRQFPVTWALASLTDFLKSL
A0A3R5WKR1_BALF1-0      RRQFPVTWALASLTDFLKSL
A0A0C7TUX3_BALF1-0      RRQFPVTWALASLTDFLKSL
A0A0C7TPI3_BALF1-0      RRQFPVTWALASLTDFLKSL
A0A0C7TLW1_BALF1-0      RRQFPVTWALASLTDFLKSL
A0A0C7T5J4_BALF1-0      RRQFPVTWALASLTDFLKSL
A0A0C7TV67_BALF1-0      RRQFPVTWALASLTDFLKSL
A0A075FFB0_BALF1-0      RRQFPVTWALASLTDFLKSL
A0A075FCZ0_BALF1-0      KRQFPVTWALASLTDFLKSL
A0A0C7T546_BALF1-0      RRQFPVTWALASLTDFLKSL
A0A0C7T8J1_BALF1-0      RRQFPVTWALASLTDFLKSL
A0A0C7TJ32_BALF1-0      RRQFPVTWALASLTDFLKSL
A0A2D1LYV4_BALF1-0      RCQFPVTWALASLTDFLKSL
A0A3R5WNA2_BALF1-0      RRQFPVTWALASLTDFLKSL
A0A3R5WV36_BALF1-0      RRQFPVTWALASLTDFLKSL
A0A3R5WYW3_BALF1-0      RRQFPVTWALASLTDFLKSL
A0A3R5ZJV6_BALF1-0      RRQFPVTWALASLTDFLKSL
K9UT94_BALF1-01         RRQFPVTWALASLTDFLKSL
Q99F65_BALF1-01         RRQFPVTWAMAGLTDFLKSL
Q99F66_BALF1-01         RRQFPVTWAIASLSDFLKSL
Q91HI3_BALF1-01         RRQFPVRWALAGLTYFLKSL
                        . **** *::*.*: *****

© 1998-2019