Dataset for protein A9 of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1L2JVL1_A9-01      -----------------------------------------MKMLGEPEF
O36423_A9-01          -----------------------------------------MKMLGEPEF
A1BM64_A9-01          MVEAGILSRKVTTGSHWTFFTPQTLKKGACLWKAGAVYFPPASMPPRKAF
Q2VSG7_A9-01          MVEAGILSRKVTTGSHWTFFTPQTLKKGACLWKAGAVYFPPVSMPPRKAF
                                                                .*     *

A0A1L2JVL1_A9-01      KE-NILYYSFLNELFLILIRNGFSCSHAKLILDETRKRGLECSGQFEVIS
O36423_A9-01          KE-NILYYSFLNELFLILIRNGFSCSHAKLILDETRKRGLECSGQFEVIS
A1BM64_A9-01          NDGDLLYFNFTREIHMLLIKSGIPCSYAKGIMRAARTKAVDCSSTFEVIV
Q2VSG7_A9-01          NDGDLLYFNFTREIHMLLIKSGIPCSYAKGIMRAARTKAVDCSSTFEVIV
                      :: ::**:.* .*:.::**..*:.**:** *:  :*...::**. **** 

A0A1L2JVL1_A9-01      NSVEAPEPESLERIAKTLFTPRPHWGRLVAFLAYLAYLQKNSTEKLFWND
O36423_A9-01          NSVEAPEPESLERIAKTLFTPRPHWGRLVAFLAYLAYLQKNSTEKLFWND
A1BM64_A9-01          DGVGHPSPESLERIAKSLFTPRPNWGRVVMFFAYLFYLQISSTQKVFFRD
Q2VSG7_A9-01          DGVGHPSPESLERIAKSLFTPRPNWGRVVMFFAYLFYLQISSTQKVFFRD
                      :.*  *.*********:******:***:* *:*** *** .**:*:*:.*

A0A1L2JVL1_A9-01      HLKKLKQIVKCHIVPWTLGPRDPKPKQRPFD-KLPSAFYFLTAAASCLTL
O36423_A9-01          HLKKLKQIVKCHIVPWTLGPRDPKPKQRPFD-KLPSAFYFLTAAASCLTL
A1BM64_A9-01          HYKKIESIIEAHIVPWTLSQRKLK---EPFPLKMREVVIFFTTVASLVAM
Q2VSG7_A9-01          HYKKIESIIEAHIVPWTLSQRKLK---EPFPLKMREVVIFFTTVASLVAM
                      * **::.*::.*******. *. *    **  *: ... *:*:.** :::

A0A1L2JVL1_A9-01      LLLYFRTTQTK
O36423_A9-01          LLLYFRTTQTK
A1BM64_A9-01          LLFCRRAWS--
Q2VSG7_A9-01          LLLCRRAWG--
                      **:  *:    

© 1998-2018