Dataset for protein herpesviridae of organism Panine gammaherpesvirus 1

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q99F65_BALF1-01      -------------MRPAESTDSVFVRTPVEAWVAPSPPDDKVAESSYLMF
Q9IHR2_BHRF1-01      MAYSTRDILLALCMRDSYVHGNGSLHPVLELAARETPPRVSPEDTVVLRL
                                  ** :   ..  :.. :*  .  :**  .  ::  * :

Q99F65_BALF1-01      RAMYAVFSRDESDLPLPAAVLCRLIKASLKKDRKLYAELACKTADIGGRH
Q9IHR2_BHRF1-01      HLLL------EEVIQQNAESFTNTWETFITNAEHVDLDFAAVFEDIFHRG
                     . :       *. :   *  : .  :: :.:  ::  ::*.   **  * 

Q99F65_BALF1-01      AHVQLITSVLRAVYDDHCDYWSRLRVVLCYTVVFAVRNYLDDHRSAAFVL
Q9IHR2_BHRF1-01      DPSLGRALAWLAWCMHACRTLCRNQNTPYYVVDLSVRGMLEASEGLDAWI
                           : .  *     *   .* . .  *.* ::**. *:   .    :

Q99F65_BALF1-01      GAIAHYLALYR--------RLWFARMGGMPRSLRRQFPVTWAMAGLTDFL
Q9IHR2_BHRF1-01      HQQGGWTGLIRSDSLGSTNSRWTLLFAGLTLSLLIVCSYLFISRGRH---
                        . : .* *          *   :.*:. **    .  :   *     

Q99F65_BALF1-01      KSL
Q9IHR2_BHRF1-01      ---
                        

© 1998-2018