Dataset for protein A9 of organism Ovine gammaherpesvirus 2

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A1BM64_A9-01      MVEAGILSRKVTTGSHWTFFTPQTLKKGACLWKAGAVYFPPASMPPRKAFNDGDLLYFNF
Q2VSG7_A9-01      MVEAGILSRKVTTGSHWTFFTPQTLKKGACLWKAGAVYFPPVSMPPRKAFNDGDLLYFNF
                  *****************************************.******************

A1BM64_A9-01      TREIHMLLIKSGIPCSYAKGIMRAARTKAVDCSSTFEVIVDGVGHPSPESLERIAKSLFT
Q2VSG7_A9-01      TREIHMLLIKSGIPCSYAKGIMRAARTKAVDCSSTFEVIVDGVGHPSPESLERIAKSLFT
                  ************************************************************

A1BM64_A9-01      PRPNWGRVVMFFAYLFYLQISSTQKVFFRDHYKKIESIIEAHIVPWTLSQRKLKEPFPLK
Q2VSG7_A9-01      PRPNWGRVVMFFAYLFYLQISSTQKVFFRDHYKKIESIIEAHIVPWTLSQRKLKEPFPLK
                  ************************************************************

A1BM64_A9-01      MREVVIFFTTVASLVAMLLFCRRAWS
Q2VSG7_A9-01      MREVVIFFTTVASLVAMLLLCRRAWG
                  *******************:*****.

© 1998-2018