Dataset for protein herpesviridae of organism Meleagrid herpesvirus 1

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q9E1F2_vNR13-01      MADSLKEETALLLEDYFQHCCGKEGPPPSPTAAELRRAAAELERRERPFF
Q9E1F2_vNR13-02      MADSLKEETALLLEDYFQHCCGKEGPPPSPTAAELRRAAAELERRERPFF
                     **************************************************

Q9E1F2_vNR13-01      RSCAPLASGGTQAALSALQSVVSELNSGSGFNWGRCLATIVLGGSLATAL
Q9E1F2_vNR13-02      RSCAPLASGGTQAALSALQSVVSELNSGSGFNWGRCLATIVLGGSLATAL
                     **************************************************

Q9E1F2_vNR13-01      YENGCEEGPSRLAAALAAYLAEEQGEWLREHGGWDGFCR--FFARFGPGL
Q9E1F2_vNR13-02      YENGCEEGPSRLAAALAAYLAEEQGEWLREHGGWVSTARAGMSGSFGSPV
                     ********************************** . .*  : . **. :

Q9E1F2_vNR13-01      GEASQTFPLGLIVAAAGIGITVLIVVWQFQS
Q9E1F2_vNR13-02      SARSEEHRARR---------------W----
                     .  *: .                   *    

© 1998-2018