Dataset for protein herpesviridae of organism Epstein Barr virus

[Download (right click)] [Edit] [Sequences] [Repertoires]

70 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A0S2YQS0_BHRF1-0      --------------------MAHSTREILLALCIRDSRVHGNGVLHPVLE
A0A2H4Z4F2_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0C7U1E2_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2S1N3G0_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
V5KUE2_BHRF1-02         --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2S1N3U3_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2S1MYK7_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2S1MX38_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2S1MWX4_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2S1MNB9_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2H4Z4H8_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNASLHPVLE
A0A2H4Z4E3_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2H4Z4D9_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0S2YRE8_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0C7TWM2_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2D1LYW3_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0C7TTN2_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0C7TQI4_BHRF1-0      --------------------MAYSTRDILLALCIRDSRVHGNGALHPVLE
A0A2H4Z4I0_BHRF1-0      --------------------MAYSTRDILLALCIRDSRVHGNGALHPVLE
A0A0C7TNT4_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0C7TK05_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0C7T924_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0C7T306_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0C7SXB3_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0C7T6R4_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0C7TX82_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0X8YIW3_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2H4Z4F8_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGILHPVLE
A0A2S1MMY2_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
K9UTF7_BHRF1-01         --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
K9UTN7_BHRF1-01         --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
P03182_BHRF1-01         --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
P0C6Z1_BHRF1-01         --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
V5KU29_BHRF1-02         --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2H4Z4C5_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2S1MW70_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0B6VHG4_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0X9C4Q9_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2H4Z4I4_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGSLHPVLE
A0A2H4Z4M5_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGSLHPVLE
A0A2S1N164_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
G3CKQ0_BHRF1-01         --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2H4Z4D6_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
U5YUM6_BALF1-01         MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1N1Z2_BALF1-0      MNRAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1N2H2_BALF1-0      MNRAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MZQ8_BALF1-0      MNLAITLDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MXY9_BALF1-0      MNLAIALDFPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MU91_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MQV1_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A0U3UKR9_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVNWPDETMRPAKSTDSVFV
A0A0U3U737_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A0S2YQW9_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRQAKSTDSVFV
A0A2S1MV59_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MM94_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MP06_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MTH2_BALF1-0      MNLAIALDSHHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
P0CK58_BALF1-01         MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
P0CK59_BALF1-01         MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
Q91HV2_BALF1-01         MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A0C7TV67_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A0C7TUX3_BALF1-0      --------------------------------------MRQAKSTDSVFV
A0A0C7TPI3_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A0C7TLW1_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A075FFB0_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A075FCZ0_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A0C7T8J1_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A0C7TJ32_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A2D1LYV4_BALF1-0      --------------------------------------MRPAKSTDSVFV
K9UT94_BALF1-01         --------------------------------------MRPAKSTDSVFV
                                                              :.      .*: 

A0A0S2YQS0_BHRF1-0      LAARETPPRVSPEDTVVLRYHVLLEEIIERNSDTFTETWDRFITHTEHLD
A0A2H4Z4F2_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
A0A0C7U1E2_BHRF1-0      LASRETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A2S1N3G0_BHRF1-0      LASRETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
V5KUE2_BHRF1-02         LASRETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A2S1N3U3_BHRF1-0      LATRETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A2S1MYK7_BHRF1-0      LAARETPLCLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
A0A2S1MX38_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFLTHTEHLD
A0A2S1MWX4_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFTTHTEHLD
A0A2S1MNB9_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A2H4Z4H8_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
A0A2H4Z4E3_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNSFITHTEHVD
A0A2H4Z4D9_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A0S2YRE8_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A0C7TWM2_BHRF1-0      LAARETPLRLLPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A2D1LYW3_BHRF1-0      LAARETPLRLLPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A0C7TTN2_BHRF1-0      LAARETPLHLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A0C7TQI4_BHRF1-0      LAARETPPRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTENLD
A0A2H4Z4I0_BHRF1-0      LAARETPPRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
A0A0C7TNT4_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A0C7TK05_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A0C7T924_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A0C7T306_BHRF1-0      LAARETHLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A0C7SXB3_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A0C7T6R4_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFSETWNRFITHTEHVD
A0A0C7TX82_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A0X8YIW3_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A2H4Z4F8_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A2S1MMY2_BHRF1-0      LAARESPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
K9UTF7_BHRF1-01         LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
K9UTN7_BHRF1-01         LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
P03182_BHRF1-01         LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
P0C6Z1_BHRF1-01         LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
V5KU29_BHRF1-02         LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A2H4Z4C5_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTDHLD
A0A2S1MW70_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTGHLD
A0A0B6VHG4_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTENLD
A0A0X9C4Q9_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFIRHTEHLD
A0A2H4Z4I4_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
A0A2H4Z4M5_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
A0A2S1N164_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
G3CKQ0_BHRF1-01         LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
A0A2H4Z4D6_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTANLD
U5YUM6_BALF1-01         KTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A2S1N1Z2_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFARDEK--D
A0A2S1N2H2_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFARDEK--D
A0A2S1MZQ8_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFARDEK--D
A0A2S1MXY9_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A2S1MU91_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A2S1MQV1_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A0U3UKR9_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A0U3U737_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A0S2YQW9_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A2S1MV59_BALF1-0      RTPVEAWVAPLPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A2S1MM94_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A2S1MP06_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A2S1MTH2_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
P0CK58_BALF1-01         RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
P0CK59_BALF1-01         RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
Q91HV2_BALF1-01         RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A0C7TV67_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFARDEK--D
A0A0C7TUX3_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A0C7TPI3_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A0C7TLW1_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A075FFB0_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A075FCZ0_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A0C7T8J1_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A0C7TJ32_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A2D1LYV4_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
K9UT94_BALF1-01         RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
                         :. *:     * *          ::: * .   *   :  *       *

A0A0S2YQS0_BHRF1-0      LDFNSIFLEIFHRGDPSRGRALAWLAWCMHACRTLCCNQDTPY-------
A0A2H4Z4F2_BHRF1-0      LDFNSVFLEIFHRGDPSLGCALTWMAWGMHACWTLCCNQSTPY-------
A0A0C7U1E2_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCYNQSTPY-------
A0A2S1N3G0_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
V5KUE2_BHRF1-02         LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A2S1N3U3_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A2S1MYK7_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A2S1MX38_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A2S1MWX4_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A2S1MNB9_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A2H4Z4H8_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A2H4Z4E3_BHRF1-0      LDFNSVFVEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A2H4Z4D9_BHRF1-0      LDFNSVFVEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A0S2YRE8_BHRF1-0      LDFNSVFLEIFHRGDPRLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A0C7TWM2_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A2D1LYW3_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRRLCCNQSTPY-------
A0A0C7TTN2_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A0C7TQI4_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQYTPY-------
A0A2H4Z4I0_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A0C7TNT4_BHRF1-0      LDFNSVFLEIFHRGDPSLGRTLAWMAWCMHACRTLCCNQSTPY-------
A0A0C7TK05_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNPSTPY-------
A0A0C7T924_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A0C7T306_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A0C7SXB3_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCFNQSTPY-------
A0A0C7T6R4_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A0C7TX82_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMYACRTLCCNQSTPY-------
A0A0X8YIW3_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRALCCNQSTPY-------
A0A2H4Z4F8_BHRF1-0      LDFNSVFVEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A2S1MMY2_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
K9UTF7_BHRF1-01         LDFNSVFVEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
K9UTN7_BHRF1-01         LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
P03182_BHRF1-01         LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
P0C6Z1_BHRF1-01         LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
V5KU29_BHRF1-02         LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A2H4Z4C5_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A2S1MW70_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A0B6VHG4_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQYTPY-------
A0A0X9C4Q9_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A2H4Z4I4_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A2H4Z4M5_BHRF1-0      LDFNSVFFEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A2S1N164_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
G3CKQ0_BHRF1-01         LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A2H4Z4D6_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQYTPY-------
U5YUM6_BALF1-01         LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
A0A2S1N1Z2_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YTELACRTADIGGKDTHVRLIISV
A0A2S1N2H2_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
A0A2S1MZQ8_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
A0A2S1MXY9_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
A0A2S1MU91_BALF1-0      LPLPALVLCRLIKASLRKDREL----YAELACRTADIGGKDTHVRLIISV
A0A2S1MQV1_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADVGGKDTHVRLIISV
A0A0U3UKR9_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIRGKDTHVRLIISV
A0A0U3U737_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGDKDTHVRLIISV
A0A0S2YQW9_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
A0A2S1MV59_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
A0A2S1MM94_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
A0A2S1MP06_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRIIISV
A0A2S1MTH2_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
P0CK58_BALF1-01         LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
P0CK59_BALF1-01         LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
Q91HV2_BALF1-01         LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
A0A0C7TV67_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
A0A0C7TUX3_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
A0A0C7TPI3_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADVGGKDTHVRLIISV
A0A0C7TLW1_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YADLACRTADIGGKDTHVRLIISV
A0A075FFB0_BALF1-0      LPLPALVLCRLIKASLRKDRRL----YAELACRTADIGGKDTHVRLIISV
A0A075FCZ0_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
A0A0C7T8J1_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRIIISV
A0A0C7TJ32_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
A0A2D1LYV4_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
K9UT94_BALF1-01         LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
                        * : ::..  : ...   .  *    :   **.        .:       

A0A0S2YQS0_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A2H4Z4F2_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A0C7U1E2_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A2S1N3G0_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
V5KUE2_BHRF1-02         --------------------YVVDLSVRGMLEASEGLD------------
A0A2S1N3U3_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A2S1MYK7_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A2S1MX38_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A2S1MWX4_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A2S1MNB9_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A2H4Z4H8_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A2H4Z4E3_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A2H4Z4D9_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A0S2YRE8_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A0C7TWM2_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A2D1LYW3_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A0C7TTN2_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A0C7TQI4_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A2H4Z4I0_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A0C7TNT4_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A0C7TK05_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A0C7T924_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A0C7T306_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A0C7SXB3_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A0C7T6R4_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A0C7TX82_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A0X8YIW3_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A2H4Z4F8_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A2S1MMY2_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
K9UTF7_BHRF1-01         --------------------YVVDLSVRGMLEASEGLD------------
K9UTN7_BHRF1-01         --------------------YVVDLSVRGMLEASEGLD------------
P03182_BHRF1-01         --------------------YVVDLSVRGMLEASEGLD------------
P0C6Z1_BHRF1-01         --------------------YVVDLSVRGMLEASEGLD------------
V5KU29_BHRF1-02         --------------------YVVDLSVRGMLEASEGLD------------
A0A2H4Z4C5_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A2S1MW70_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A0B6VHG4_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A0X9C4Q9_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A2H4Z4I4_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A2H4Z4M5_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A2S1N164_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
G3CKQ0_BHRF1-01         --------------------YVVDLSVRGMLEASEGLD------------
A0A2H4Z4D6_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
U5YUM6_BALF1-01         LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A2S1N1Z2_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A2S1N2H2_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A2S1MZQ8_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A2S1MXY9_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A2S1MU91_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A2S1MQV1_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A0U3UKR9_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A0U3U737_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A0S2YQW9_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A2S1MV59_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A2S1MM94_BALF1-0      LRALYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A2S1MP06_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A2S1MTH2_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
P0CK58_BALF1-01         LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
P0CK59_BALF1-01         LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
Q91HV2_BALF1-01         LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A0C7TV67_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A0C7TUX3_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A0C7TPI3_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A0C7TLW1_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A075FFB0_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A075FCZ0_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A0C7T8J1_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A0C7TJ32_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLNDHKSAAFVLGAIAHYLAL
A0A2D1LYV4_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
K9UT94_BALF1-01         LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
                                            *.* ::**. *:  :.              

A0A0S2YQS0_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRSFSWTL-----FLAGLTLSLLVVCSY
A0A2H4Z4F2_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLAGLTLSLLVICSY
A0A0C7U1E2_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLAGLTLSLLVICSY
A0A2S1N3G0_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLAGLTLSLLVICSY
V5KUE2_BHRF1-02         ---GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLAGLTLSLLVICSY
A0A2S1N3U3_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLAGLTLSLLVICSY
A0A2S1MYK7_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLAGLTLSLLVICSY
A0A2S1MX38_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLAGLTLSLLVICSY
A0A2S1MWX4_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLAGLTLSLLVICSY
A0A2S1MNB9_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGYRRFSWTL-----FLAGLTLSLLVICSY
A0A2H4Z4H8_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLAGLTLSLLVICSY
A0A2H4Z4E3_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLAGLTLSLLVICSY
A0A2H4Z4D9_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFIWTL-----FLAGLTLSLLVICSY
A0A0S2YRE8_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLAGLTLSLLVICSY
A0A0C7TWM2_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLAGLTLSLLVICSY
A0A2D1LYW3_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLAGLTLSLLVICSY
A0A0C7TTN2_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLAGLTLSLLVICSY
A0A0C7TQI4_BHRF1-0      ---GWIHQQGGWSTLIENNIPGSRRFSWTL-----FLAGLTLSLLVICSY
A0A2H4Z4I0_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLAGLTLSLLVICSY
A0A0C7TNT4_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLAGLTLSLLVICSY
A0A0C7TK05_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLAGLTLSLLVICSY
A0A0C7T924_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRKFSWTL-----FLAGLTLSLLVICSY
A0A0C7T306_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLAGLTLSLLVICSY
A0A0C7SXB3_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLAGLTLSLLVICSY
A0A0C7T6R4_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLAGLTLSLLVICSY
A0A0C7TX82_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLAGLTLSLLVICSY
A0A0X8YIW3_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLAGLTLSLLVICSY
A0A2H4Z4F8_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLAGLTLSLLVICSY
A0A2S1MMY2_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLAGLTLSLLVICSY
K9UTF7_BHRF1-01         ---GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLAGLTLSLLVICSY
K9UTN7_BHRF1-01         ---GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLAGLTLSLLVICSY
P03182_BHRF1-01         ---GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLAGLTLSLLVICSY
P0C6Z1_BHRF1-01         ---GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLAGLTLSLLVICSY
V5KU29_BHRF1-02         ---GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLAGLTLSLLVICSY
A0A2H4Z4C5_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLAGLTLSLLVICSY
A0A2S1MW70_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLAGLTLSLLVICSY
A0A0B6VHG4_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLAGLTLSLLVICSY
A0A0X9C4Q9_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLAGLTLSLLVICSY
A0A2H4Z4I4_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLAGLTLSLLVICSY
A0A2H4Z4M5_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLAGLTLSLLVICSY
A0A2S1N164_BHRF1-0      ---GWIHQQGGWSTLIEDNFPGSRRFSWTL-----FLAGLTLSLLVICSY
G3CKQ0_BHRF1-01         ---GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLAGLTLSLLVICSY
A0A2H4Z4D6_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLAGLTLSLLVICSY
U5YUM6_BALF1-01         YRRLWFARLGGMPRSLRRQFP----VTWALASLTDFLKSL----------
A0A2S1N1Z2_BALF1-0      YRRLWFARLGGMPRSLRRQFP----VTWALASLTDFLKSL----------
A0A2S1N2H2_BALF1-0      YRRLWFARLGGMPRSLRRQFP----VTWALASLTDFLKSL----------
A0A2S1MZQ8_BALF1-0      YRRLWFARLGGMPRSLRRQFP----VTWALASLTDFLKSL----------
A0A2S1MXY9_BALF1-0      YRRPWFARLGGMPRSLRRQFP----VTWALASLTDFLKSL----------
A0A2S1MU91_BALF1-0      YRRLWFARLGGMPRSLRRQFP----VTWALASLTDFLKSL----------
A0A2S1MQV1_BALF1-0      YRRLWFARLGGMPRSLRRQFP----VTWALASLTDFLKSL----------
A0A0U3UKR9_BALF1-0      YRRLWFARLGGMPRSLRRQFP----VTWALASLTDFLKSL----------
A0A0U3U737_BALF1-0      YRRLWFARLGGMPRSLRRQFP----VTWALASLTDFLKSL----------
A0A0S2YQW9_BALF1-0      YRRLWFARLGGMPRSLRRQFP----VTWALASLTDFLKSL----------
A0A2S1MV59_BALF1-0      YRRLWFARLGGMPRSLRRQFP----VTWALASLTDFLKSL----------
A0A2S1MM94_BALF1-0      YRRLWFARLGGMPRSLRRQFP----VTWALASLTDFLKSL----------
A0A2S1MP06_BALF1-0      YRRLWFARLGGMPRSLRRQFP----VTWALASLTDFLKSL----------
A0A2S1MTH2_BALF1-0      YRRLWFARLGGMPRSLRRQFP----VTWALASLTDFLKSL----------
P0CK58_BALF1-01         YRRLWFARLGGMPRSLRRQFP----VTWALASLTDFLKSL----------
P0CK59_BALF1-01         YRRLWFARLGGMPRSLRRQFP----VTWALASLTDFLKSL----------
Q91HV2_BALF1-01         YRRLWFARLGGMPRSLRCQFP----VTWALASLTDFLKSL----------
A0A0C7TV67_BALF1-0      YRRIWFARLGGMPRSLRRQFP----VTWALASLTDFLKSL----------
A0A0C7TUX3_BALF1-0      YRRLWFARLGGMPRSLRRQFP----VTWALASLTDFLKSL----------
A0A0C7TPI3_BALF1-0      YRRLWFARLGGMPRSLRRQFP----VTWALASLTDFLKSL----------
A0A0C7TLW1_BALF1-0      YRRLWFARLGGMPRSLRRQFP----VTWALASLTDFLKSL----------
A0A075FFB0_BALF1-0      YRRLWFARLGGMPRSLRRQFP----VTWALASLTDFLKSL----------
A0A075FCZ0_BALF1-0      YRRLWFARLGGMPRSLKRQFP----VTWALASLTDFLKSL----------
A0A0C7T8J1_BALF1-0      YRRLWFARLGGMPRSLRRQFP----VTWALASLTDFLKSL----------
A0A0C7TJ32_BALF1-0      YRRLWFARLGGMPRSLRRQFP----VTWALASLTDFLKSL----------
A0A2D1LYV4_BALF1-0      YRRLWFARLGGMPRSLRCQFP----VTWALASLTDFLKSL----------
K9UT94_BALF1-01         YRRLWFARLGGMPRSLRRQFP----VTWALASLTDFLKSL----------
                            *: . ** .  :  ::*    . *:*     ** .*          

A0A0S2YQS0_BHRF1-0      LFISRGRH
A0A2H4Z4F2_BHRF1-0      LFISRGRH
A0A0C7U1E2_BHRF1-0      LFISRGRH
A0A2S1N3G0_BHRF1-0      LFISRGRQ
V5KUE2_BHRF1-02         LFISRGRH
A0A2S1N3U3_BHRF1-0      LFISRGRH
A0A2S1MYK7_BHRF1-0      LFISRGRH
A0A2S1MX38_BHRF1-0      LFISRGRH
A0A2S1MWX4_BHRF1-0      LFISRGRH
A0A2S1MNB9_BHRF1-0      LFISRGRH
A0A2H4Z4H8_BHRF1-0      LFISRGRH
A0A2H4Z4E3_BHRF1-0      LFISRGRH
A0A2H4Z4D9_BHRF1-0      LFISRGRH
A0A0S2YRE8_BHRF1-0      LFISRGRH
A0A0C7TWM2_BHRF1-0      LFISRGRH
A0A2D1LYW3_BHRF1-0      LFISRGRH
A0A0C7TTN2_BHRF1-0      LFISRGRH
A0A0C7TQI4_BHRF1-0      LFISRGRH
A0A2H4Z4I0_BHRF1-0      LFISRGRH
A0A0C7TNT4_BHRF1-0      LFISRGRH
A0A0C7TK05_BHRF1-0      LFISRGRH
A0A0C7T924_BHRF1-0      LFISRGRH
A0A0C7T306_BHRF1-0      LFISRGRH
A0A0C7SXB3_BHRF1-0      LFISRGRH
A0A0C7T6R4_BHRF1-0      LFISRGRH
A0A0C7TX82_BHRF1-0      LFISRGRH
A0A0X8YIW3_BHRF1-0      LFISRGRH
A0A2H4Z4F8_BHRF1-0      LFISRGRH
A0A2S1MMY2_BHRF1-0      LFISRGRH
K9UTF7_BHRF1-01         LFISRGRH
K9UTN7_BHRF1-01         LFISRGRH
P03182_BHRF1-01         LFISRGRH
P0C6Z1_BHRF1-01         LFISRGRH
V5KU29_BHRF1-02         LFISRGRQ
A0A2H4Z4C5_BHRF1-0      LFISRGRH
A0A2S1MW70_BHRF1-0      LFISRGRH
A0A0B6VHG4_BHRF1-0      LFISRGRH
A0A0X9C4Q9_BHRF1-0      LFISRGRH
A0A2H4Z4I4_BHRF1-0      LFISRGRH
A0A2H4Z4M5_BHRF1-0      LFISRGRH
A0A2S1N164_BHRF1-0      LFISRGRH
G3CKQ0_BHRF1-01         LFISRGRH
A0A2H4Z4D6_BHRF1-0      LFISRGRH
U5YUM6_BALF1-01         --------
A0A2S1N1Z2_BALF1-0      --------
A0A2S1N2H2_BALF1-0      --------
A0A2S1MZQ8_BALF1-0      --------
A0A2S1MXY9_BALF1-0      --------
A0A2S1MU91_BALF1-0      --------
A0A2S1MQV1_BALF1-0      --------
A0A0U3UKR9_BALF1-0      --------
A0A0U3U737_BALF1-0      --------
A0A0S2YQW9_BALF1-0      --------
A0A2S1MV59_BALF1-0      --------
A0A2S1MM94_BALF1-0      --------
A0A2S1MP06_BALF1-0      --------
A0A2S1MTH2_BALF1-0      --------
P0CK58_BALF1-01         --------
P0CK59_BALF1-01         --------
Q91HV2_BALF1-01         --------
A0A0C7TV67_BALF1-0      --------
A0A0C7TUX3_BALF1-0      --------
A0A0C7TPI3_BALF1-0      --------
A0A0C7TLW1_BALF1-0      --------
A0A075FFB0_BALF1-0      --------
A0A075FCZ0_BALF1-0      --------
A0A0C7T8J1_BALF1-0      --------
A0A0C7TJ32_BALF1-0      --------
A0A2D1LYV4_BALF1-0      --------
K9UT94_BALF1-01         --------
                                

© 1998-2019