Dataset for protein herpesviridae of organism Epstein Barr virus

[Download (right click)] [Edit] [Sequences] [Repertoires]

51 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A0S2YQS0_BHRF1-0      ------------------------------------------------MA
A0A2H4Z4F2_BHRF1-0      ------------------------------------------------MA
A0A0C7U1E2_BHRF1-0      ------------------------------------------------MA
V5KUE2_BHRF1-02         ------------------------------------------------MA
A0A2H4Z4H8_BHRF1-0      ------------------------------------------------MA
A0A2H4Z4E3_BHRF1-0      ------------------------------------------------MA
A0A2H4Z4D9_BHRF1-0      ------------------------------------------------MA
A0A0S2YRE8_BHRF1-0      ------------------------------------------------MA
A0A0C7TWM2_BHRF1-0      ------------------------------------------------MA
A0A2D1LYW3_BHRF1-0      ------------------------------------------------MA
A0A0C7TTN2_BHRF1-0      ------------------------------------------------MA
A0A0C7TQI4_BHRF1-0      ------------------------------------------------MA
A0A2H4Z4I0_BHRF1-0      ------------------------------------------------MA
A0A0C7TNT4_BHRF1-0      ------------------------------------------------MA
A0A0C7TK05_BHRF1-0      ------------------------------------------------MA
A0A0C7T924_BHRF1-0      ------------------------------------------------MA
A0A0C7T306_BHRF1-0      ------------------------------------------------MA
A0A0C7SXB3_BHRF1-0      ------------------------------------------------MA
A0A0C7T6R4_BHRF1-0      ------------------------------------------------MA
A0A0C7TX82_BHRF1-0      ------------------------------------------------MA
A0A0X8YIW3_BHRF1-0      ------------------------------------------------MA
A0A2H4Z4F8_BHRF1-0      ------------------------------------------------MA
K9UTF7_BHRF1-01         ------------------------------------------------MA
K9UTN7_BHRF1-01         ------------------------------------------------MA
P03182_BHRF1-01         ------------------------------------------------MA
P0C6Z1_BHRF1-01         ------------------------------------------------MA
V5KU29_BHRF1-02         ------------------------------------------------MA
A0A2H4Z4C5_BHRF1-0      ------------------------------------------------MA
A0A2H4Z4D6_BHRF1-0      ------------------------------------------------MA
A0A0B6VHG4_BHRF1-0      ------------------------------------------------MA
A0A0X9C4Q9_BHRF1-0      ------------------------------------------------MA
A0A2H4Z4I4_BHRF1-0      ------------------------------------------------MA
A0A2H4Z4M5_BHRF1-0      ------------------------------------------------MA
G3CKQ0_BHRF1-01         ------------------------------------------------MA
U5YUM6_BALF1-01         MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A0U3UKR9_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVNWPDETMRPAKSTDSVFV
A0A0U3U737_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A0S2YQW9_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRQAKSTDSVFV
P0CK58_BALF1-01         MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
P0CK59_BALF1-01         MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
Q91HV2_BALF1-01         MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A0C7TV67_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A0C7TUX3_BALF1-0      --------------------------------------MRQAKSTDSVFV
A0A0C7TPI3_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A0C7TLW1_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A075FFB0_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A075FCZ0_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A0C7T8J1_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A0C7TJ32_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A2D1LYV4_BALF1-0      --------------------------------------MRPAKSTDSVFV
K9UT94_BALF1-01         --------------------------------------MRPAKSTDSVFV
                                                                        :.

A0A0S2YQS0_BHRF1-0      HSTREILLALCIRDSRVHGNG-----VLHPVLELAARETPPRVSPEDTVV
A0A2H4Z4F2_BHRF1-0      YSTREILLALCIRDSRVHGNG-----TLHPVLELAARETPLRLSPEDTVV
A0A0C7U1E2_BHRF1-0      YSTREILLALCIRDSRVHGNG-----TLHPVLELASRETPLRLSPEDTVV
V5KUE2_BHRF1-02         YSTREILLALCIRDSRVHGNG-----TLHPVLELASRETPLRLSPEDTVV
A0A2H4Z4H8_BHRF1-0      YSTREILLALCIRDSRVHGNA-----SLHPVLELAARETPLRLSPEDTVV
A0A2H4Z4E3_BHRF1-0      YSTREILLALCIRDSRVHGNG-----TLHPVLELAARETPLRLSPEDTVV
A0A2H4Z4D9_BHRF1-0      YSTREILLALCIRDSRVHGNG-----TLHPVLELAARETPLRLSPEDTVV
A0A0S2YRE8_BHRF1-0      YSTREILLALCIRDSRVHGNG-----TLHPVLELAARETPLRLSPEDTVV
A0A0C7TWM2_BHRF1-0      YSTREILLALCIRDSRVHGNG-----TLHPVLELAARETPLRLLPEDTVV
A0A2D1LYW3_BHRF1-0      YSTREILLALCIRDSRVHGNG-----TLHPVLELAARETPLRLLPEDTVV
A0A0C7TTN2_BHRF1-0      YSTREILLALCIRDSRVHGNG-----TLHPVLELAARETPLHLSPEDTVV
A0A0C7TQI4_BHRF1-0      YSTRDILLALCIRDSRVHGNG-----ALHPVLELAARETPPRLSPEDTVV
A0A2H4Z4I0_BHRF1-0      YSTRDILLALCIRDSRVHGNG-----ALHPVLELAARETPPRLSPEDTVV
A0A0C7TNT4_BHRF1-0      YSTREILLALCIRDSRVHGNG-----TLHPVLELAARETPLRLSPEDTVV
A0A0C7TK05_BHRF1-0      YSTREILLALCIRDSRVHGNG-----TLHPVLELAARETPLRLSPEDTVV
A0A0C7T924_BHRF1-0      YSTREILLALCIRDSRVHGNG-----TLHPVLELAARETPLRLSPEDTVV
A0A0C7T306_BHRF1-0      YSTREILLALCIRDSRVHGNG-----TLHPVLELAARETHLRLSPEDTVV
A0A0C7SXB3_BHRF1-0      YSTREILLALCIRDSRVHGNG-----TLHPVLELAARETPLRLSPEDTVV
A0A0C7T6R4_BHRF1-0      YSTREILLALCIRDSRVHGNG-----TLHPVLELAARETPLRLSPEDTVV
A0A0C7TX82_BHRF1-0      YSTREILLALCIRDSRVHGNG-----TLHPVLELAARETPLRLSPEDTVV
A0A0X8YIW3_BHRF1-0      YSTREILLALCIRDSRVHGNG-----TLHPVLELAARETPLRLSPEDTVV
A0A2H4Z4F8_BHRF1-0      YSTREILLALCIRDSRVHGNG-----ILHPVLELAARETPLRLSPEDTVV
K9UTF7_BHRF1-01         YSTREILLALCIRDSRVHGNG-----TLHPVLELAARETPLRLSPEDTVV
K9UTN7_BHRF1-01         YSTREILLALCIRDSRVHGNG-----TLHPVLELAARETPLRLSPEDTVV
P03182_BHRF1-01         YSTREILLALCIRDSRVHGNG-----TLHPVLELAARETPLRLSPEDTVV
P0C6Z1_BHRF1-01         YSTREILLALCIRDSRVHGNG-----TLHPVLELAARETPLRLSPEDTVV
V5KU29_BHRF1-02         YSTREILLALCIRDSRVHGNG-----TLHPVLELAARETPLRLSPEDTVV
A0A2H4Z4C5_BHRF1-0      YSTREILLALCIRDSRVHGNG-----TLHPVLELAARETPLRLSPEDTVV
A0A2H4Z4D6_BHRF1-0      YSTREILLALCIRDSRVHGNG-----TLHPVLELAARETPLRLSPEDTVV
A0A0B6VHG4_BHRF1-0      YSTREILLALCIRDSRVHGNG-----TLHPVLELAARETPLRLSPEDTVV
A0A0X9C4Q9_BHRF1-0      YSTREILLALCIRDSRVHGNG-----TLHPVLELAARETPLRLSPEDTVV
A0A2H4Z4I4_BHRF1-0      YSTREILLALCIRDSRVHGNG-----SLHPVLELAARETPLRLSPEDTVV
A0A2H4Z4M5_BHRF1-0      YSTREILLALCIRDSRVHGNG-----SLHPVLELAARETPLRLSPEDTVV
G3CKQ0_BHRF1-01         YSTREILLALCIRDSRVHGNG-----TLHPVLELAARETPLRLSPEDTVV
U5YUM6_BALF1-01         KTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLP-------A
A0A0U3UKR9_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLP-------A
A0A0U3U737_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLP-------A
A0A0S2YQW9_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLP-------A
P0CK58_BALF1-01         RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLP-------A
P0CK59_BALF1-01         RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLP-------A
Q91HV2_BALF1-01         RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLP-------A
A0A0C7TV67_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFARDEKDLPLP-------A
A0A0C7TUX3_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLP-------A
A0A0C7TPI3_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLP-------A
A0A0C7TLW1_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLP-------A
A0A075FFB0_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLP-------A
A0A075FCZ0_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLP-------A
A0A0C7T8J1_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLP-------A
A0A0C7TJ32_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLP-------A
A0A2D1LYV4_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLP-------A
K9UT94_BALF1-01         RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLP-------A
                         :. :  :* .  *..*  ..      ::.*:    .:           .

A0A0S2YQS0_BHRF1-0      LRYHVLLEEIIERNSDTFTETWDRFI------THTEHLDLDFNSIFLEIF
A0A2H4Z4F2_BHRF1-0      LRYHVLLEEIIERNSETFTETWNRFI------THTEHLDLDFNSVFLEIF
A0A0C7U1E2_BHRF1-0      LRYHVLLEEIIERNSETFTETWNRFI------THTEHVDLDFNSVFLEIF
V5KUE2_BHRF1-02         LRYHVLLEEIIERNSETFTETWNRFI------THTEHVDLDFNSVFLEIF
A0A2H4Z4H8_BHRF1-0      LRYHVLLEEIIERNSETFTETWNRFI------THTEHLDLDFNSVFLEIF
A0A2H4Z4E3_BHRF1-0      LRYHVLLEEIIERNSETFTETWNSFI------THTEHVDLDFNSVFVEIF
A0A2H4Z4D9_BHRF1-0      LRYHVLLEEIIERNSETFTETWNRFI------THTEHVDLDFNSVFVEIF
A0A0S2YRE8_BHRF1-0      LRYHVLLEEIIERNSETFTETWNRFI------THTEHVDLDFNSVFLEIF
A0A0C7TWM2_BHRF1-0      LRYHVLLEEIIERNSETFTETWNRFI------THTEHVDLDFNSVFLEIF
A0A2D1LYW3_BHRF1-0      LRYHVLLEEIIERNSETFTETWNRFI------THTEHVDLDFNSVFLEIF
A0A0C7TTN2_BHRF1-0      LRYHVLLEEIIERNSETFTETWNRFI------THTEHVDLDFNSVFLEIF
A0A0C7TQI4_BHRF1-0      LRYHVLLEEIIERNSETFTETWNRFI------THTENLDLDFNSVFLEIF
A0A2H4Z4I0_BHRF1-0      LRYHVLLEEIIERNSETFTETWNRFI------THTEHLDLDFNSVFLEIF
A0A0C7TNT4_BHRF1-0      LRYHVLLEEIIERNSETFTETWNRFI------THTEHVDLDFNSVFLEIF
A0A0C7TK05_BHRF1-0      LRYHVLLEEIIERNSETFTETWNRFI------THTEHVDLDFNSVFLEIF
A0A0C7T924_BHRF1-0      LRYHVLLEEIIERNSETFTETWNRFI------THTEHVDLDFNSVFLEIF
A0A0C7T306_BHRF1-0      LRYHVLLEEIIERNSETFTETWNRFI------THTEHVDLDFNSVFLEIF
A0A0C7SXB3_BHRF1-0      LRYHVLLEEIIERNSETFTETWNRFI------THTEHVDLDFNSVFLEIF
A0A0C7T6R4_BHRF1-0      LRYHVLLEEIIERNSETFSETWNRFI------THTEHVDLDFNSVFLEIF
A0A0C7TX82_BHRF1-0      LRYHVLLEEIIERNSETFTETWNRFI------THTEHVDLDFNSVFLEIF
A0A0X8YIW3_BHRF1-0      LRYHVLLEEIIERNSETFTETWNRFI------THTEHVDLDFNSVFLEIF
A0A2H4Z4F8_BHRF1-0      LRYHVLLEEIIERNSETFTETWNRFI------THTEHVDLDFNSVFVEIF
K9UTF7_BHRF1-01         LRYHVLLEEIIERNSETFTETWNRFI------THTEHVDLDFNSVFVEIF
K9UTN7_BHRF1-01         LRYHVLLEEIIERNSETFTETWNRFI------THTEHVDLDFNSVFLEIF
P03182_BHRF1-01         LRYHVLLEEIIERNSETFTETWNRFI------THTEHVDLDFNSVFLEIF
P0C6Z1_BHRF1-01         LRYHVLLEEIIERNSETFTETWNRFI------THTEHVDLDFNSVFLEIF
V5KU29_BHRF1-02         LRYHVLLEEIIERNSETFTETWNRFI------THTEHVDLDFNSVFLEIF
A0A2H4Z4C5_BHRF1-0      LRYHVLLEEIIERNSETFTETWNRFI------THTDHLDLDFNSVFLEIF
A0A2H4Z4D6_BHRF1-0      LRYHVLLEEIIERNSETFTETWNRFI------THTANLDLDFNSVFLEIF
A0A0B6VHG4_BHRF1-0      LRYHVLLEEIIERNSETFTETWNRFI------THTENLDLDFNSVFLEIF
A0A0X9C4Q9_BHRF1-0      LRYHVLLEEIIERNSETFTETWNRFI------RHTEHLDLDFNSVFLEIF
A0A2H4Z4I4_BHRF1-0      LRYHVLLEEIIERNSETFTETWNRFI------THTEHLDLDFNSVFLEIF
A0A2H4Z4M5_BHRF1-0      LRYHVLLEEIIERNSETFTETWNRFI------THTEHLDLDFNSVFFEIF
G3CKQ0_BHRF1-01         LRYHVLLEEIIERNSETFTETWNRFI------THTEHLDLDFNSVFLEIF
U5YUM6_BALF1-01         LVLCRLIKASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHY
A0A0U3UKR9_BALF1-0      LVLCRLIKASLRKDRKLYAELACRTADIRGKDTHVRLIISVLRAVYNDHY
A0A0U3U737_BALF1-0      LVLCRLIKASLRKDRKLYAELACRTADIGDKDTHVRLIISVLRAVYNDHY
A0A0S2YQW9_BALF1-0      LVLCRLIKASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHY
P0CK58_BALF1-01         LVLCRLIKASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHY
P0CK59_BALF1-01         LVLCRLIKASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHY
Q91HV2_BALF1-01         LVLCRLIKASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHY
A0A0C7TV67_BALF1-0      LVLCRLIKASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHY
A0A0C7TUX3_BALF1-0      LVLCRLIKASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHY
A0A0C7TPI3_BALF1-0      LVLCRLIKASLRKDRKLYAELACRTADVGGKDTHVRLIISVLRAVYNDHY
A0A0C7TLW1_BALF1-0      LVLCRLIKASLRKDRKLYADLACRTADIGGKDTHVRLIISVLRAVYNDHY
A0A075FFB0_BALF1-0      LVLCRLIKASLRKDRRLYAELACRTADIGGKDTHVRLIISVLRAVYNDHY
A0A075FCZ0_BALF1-0      LVLCRLIKASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHY
A0A0C7T8J1_BALF1-0      LVLCRLIKASLRKDRKLYAELACRTADIGGKDTHVRIIISVLRAVYNDHY
A0A0C7TJ32_BALF1-0      LVLCRLIKASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHY
A0A2D1LYV4_BALF1-0      LVLCRLIKASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHY
K9UT94_BALF1-01         LVLCRLIKASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHY
                        *    *::  : .:   :::             *.  :   :.::: : :

A0A0S2YQS0_BHRF1-0      HRGDPSRGRALAWLAWCMHACRTLCCNQDTPYYVVDLSVRGMLEASEGLD
A0A2H4Z4F2_BHRF1-0      HRGDPSLGCALTWMAWGMHACWTLCCNQSTPYYVVDLSVRGMLEASEGLD
A0A0C7U1E2_BHRF1-0      HRGDPSLGRALAWMAWCMHACRTLCYNQSTPYYVVDLSVRGMLEASEGLD
V5KUE2_BHRF1-02         HRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLD
A0A2H4Z4H8_BHRF1-0      HRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLD
A0A2H4Z4E3_BHRF1-0      HRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLD
A0A2H4Z4D9_BHRF1-0      HRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLD
A0A0S2YRE8_BHRF1-0      HRGDPRLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLD
A0A0C7TWM2_BHRF1-0      HRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLD
A0A2D1LYW3_BHRF1-0      HRGDPSLGRALAWMAWCMHACRRLCCNQSTPYYVVDLSVRGMLEASEGLD
A0A0C7TTN2_BHRF1-0      HRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLD
A0A0C7TQI4_BHRF1-0      HRGDPSLGRALAWMAWCMHACRTLCCNQYTPYYVVDLSVRGMLEASEGLD
A0A2H4Z4I0_BHRF1-0      HRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLD
A0A0C7TNT4_BHRF1-0      HRGDPSLGRTLAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLD
A0A0C7TK05_BHRF1-0      HRGDPSLGRALAWMAWCMHACRTLCCNPSTPYYVVDLSVRGMLEASEGLD
A0A0C7T924_BHRF1-0      HRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLD
A0A0C7T306_BHRF1-0      HRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLD
A0A0C7SXB3_BHRF1-0      HRGDPSLGRALAWMAWCMHACRTLCFNQSTPYYVVDLSVRGMLEASEGLD
A0A0C7T6R4_BHRF1-0      HRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLD
A0A0C7TX82_BHRF1-0      HRGDPSLGRALAWMAWCMYACRTLCCNQSTPYYVVDLSVRGMLEASEGLD
A0A0X8YIW3_BHRF1-0      HRGDPSLGRALAWMAWCMHACRALCCNQSTPYYVVDLSVRGMLEASEGLD
A0A2H4Z4F8_BHRF1-0      HRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLD
K9UTF7_BHRF1-01         HRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLD
K9UTN7_BHRF1-01         HRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLD
P03182_BHRF1-01         HRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLD
P0C6Z1_BHRF1-01         HRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLD
V5KU29_BHRF1-02         HRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLD
A0A2H4Z4C5_BHRF1-0      HRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLD
A0A2H4Z4D6_BHRF1-0      HRGDPSLGRALAWMAWCMHACRTLCCNQYTPYYVVDLSVRGMLEASEGLD
A0A0B6VHG4_BHRF1-0      HRGDPSLGRALAWMAWCMHACRTLCCNQYTPYYVVDLSVRGMLEASEGLD
A0A0X9C4Q9_BHRF1-0      HRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLD
A0A2H4Z4I4_BHRF1-0      HRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLD
A0A2H4Z4M5_BHRF1-0      HRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLD
G3CKQ0_BHRF1-01         HRGDPSLGRALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLD
U5YUM6_BALF1-01         DY----------WSRLRVVLC-----------YTVVFAVRNYLDDHKSAA
A0A0U3UKR9_BALF1-0      DY----------WSRLRVVLC-----------YTVVFAVRNYLDDHKSAA
A0A0U3U737_BALF1-0      DY----------WSRLRVVLC-----------YTVVFAVRNYLDDHKSAA
A0A0S2YQW9_BALF1-0      DY----------WSRLRVVLC-----------YTVVFAVRNYLDDHKSAA
P0CK58_BALF1-01         DY----------WSRLRVVLC-----------YTVVFAVRNYLDDHKSAA
P0CK59_BALF1-01         DY----------WSRLRVVLC-----------YTVVFAVRNYLDDHKSAA
Q91HV2_BALF1-01         DY----------WSRLRVVLC-----------YTVVFAVRNYLDDHKSAA
A0A0C7TV67_BALF1-0      DY----------WSRLRVVLC-----------YTVVFAVRNYLDDHKSAA
A0A0C7TUX3_BALF1-0      DY----------WSRLRVVLC-----------YTVVFAVRNYLDDHKSAA
A0A0C7TPI3_BALF1-0      DY----------WSRLRVVLC-----------YTVVFAVRNYLDDHKSAA
A0A0C7TLW1_BALF1-0      DY----------WSRLRVVLC-----------YTVVFAVRNYLDDHKSAA
A0A075FFB0_BALF1-0      DY----------WSRLRVVLC-----------YTVVFAVRNYLDDHKSAA
A0A075FCZ0_BALF1-0      DY----------WSRLRVVLC-----------YTVVFAVRNYLDDHKSAA
A0A0C7T8J1_BALF1-0      DY----------WSRLRVVLC-----------YTVVFAVRNYLDDHKSAA
A0A0C7TJ32_BALF1-0      DY----------WSRLRVVLC-----------YTVVFAVRNYLNDHKSAA
A0A2D1LYV4_BALF1-0      DY----------WSRLRVVLC-----------YTVVFAVRNYLDDHKSAA
K9UT94_BALF1-01         DY----------WSRLRVVLC-----------YTVVFAVRNYLDDHKSAA
                                    *    :  *           *.* ::**. *:  :.  

A0A0S2YQS0_BHRF1-0      ---------------GWIHQQGGWSTLIEDNIPGSRSFSWTL-----FLA
A0A2H4Z4F2_BHRF1-0      ---------------GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLA
A0A0C7U1E2_BHRF1-0      ---------------GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLA
V5KUE2_BHRF1-02         ---------------GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLA
A0A2H4Z4H8_BHRF1-0      ---------------GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLA
A0A2H4Z4E3_BHRF1-0      ---------------GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLA
A0A2H4Z4D9_BHRF1-0      ---------------GWIHQQGGWSTLIEDNIPGSRRFIWTL-----FLA
A0A0S2YRE8_BHRF1-0      ---------------GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLA
A0A0C7TWM2_BHRF1-0      ---------------GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLA
A0A2D1LYW3_BHRF1-0      ---------------GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLA
A0A0C7TTN2_BHRF1-0      ---------------GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLA
A0A0C7TQI4_BHRF1-0      ---------------GWIHQQGGWSTLIENNIPGSRRFSWTL-----FLA
A0A2H4Z4I0_BHRF1-0      ---------------GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLA
A0A0C7TNT4_BHRF1-0      ---------------GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLA
A0A0C7TK05_BHRF1-0      ---------------GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLA
A0A0C7T924_BHRF1-0      ---------------GWIHQQGGWSTLIEDNIPGSRKFSWTL-----FLA
A0A0C7T306_BHRF1-0      ---------------GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLA
A0A0C7SXB3_BHRF1-0      ---------------GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLA
A0A0C7T6R4_BHRF1-0      ---------------GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLA
A0A0C7TX82_BHRF1-0      ---------------GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLA
A0A0X8YIW3_BHRF1-0      ---------------GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLA
A0A2H4Z4F8_BHRF1-0      ---------------GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLA
K9UTF7_BHRF1-01         ---------------GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLA
K9UTN7_BHRF1-01         ---------------GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLA
P03182_BHRF1-01         ---------------GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLA
P0C6Z1_BHRF1-01         ---------------GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLA
V5KU29_BHRF1-02         ---------------GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLA
A0A2H4Z4C5_BHRF1-0      ---------------GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLA
A0A2H4Z4D6_BHRF1-0      ---------------GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLA
A0A0B6VHG4_BHRF1-0      ---------------GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLA
A0A0X9C4Q9_BHRF1-0      ---------------GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLA
A0A2H4Z4I4_BHRF1-0      ---------------GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLA
A0A2H4Z4M5_BHRF1-0      ---------------GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLA
G3CKQ0_BHRF1-01         ---------------GWIHQQGGWSTLIEDNIPGSRRFSWTL-----FLA
U5YUM6_BALF1-01         FVLGAIAHYLALYRRLWFARLGGMPRSLRRQFP----VTWALASLTDFLK
A0A0U3UKR9_BALF1-0      FVLGAIAHYLALYRRLWFARLGGMPRSLRRQFP----VTWALASLTDFLK
A0A0U3U737_BALF1-0      FVLGAIAHYLALYRRLWFARLGGMPRSLRRQFP----VTWALASLTDFLK
A0A0S2YQW9_BALF1-0      FVLGAIAHYLALYRRLWFARLGGMPRSLRRQFP----VTWALASLTDFLK
P0CK58_BALF1-01         FVLGAIAHYLALYRRLWFARLGGMPRSLRRQFP----VTWALASLTDFLK
P0CK59_BALF1-01         FVLGAIAHYLALYRRLWFARLGGMPRSLRRQFP----VTWALASLTDFLK
Q91HV2_BALF1-01         FVLGAIAHYLALYRRLWFARLGGMPRSLRCQFP----VTWALASLTDFLK
A0A0C7TV67_BALF1-0      FVLGAIAHYLALYRRIWFARLGGMPRSLRRQFP----VTWALASLTDFLK
A0A0C7TUX3_BALF1-0      FVLGAIAHYLALYRRLWFARLGGMPRSLRRQFP----VTWALASLTDFLK
A0A0C7TPI3_BALF1-0      FVLGAIAHYLALYRRLWFARLGGMPRSLRRQFP----VTWALASLTDFLK
A0A0C7TLW1_BALF1-0      FVLGAIAHYLALYRRLWFARLGGMPRSLRRQFP----VTWALASLTDFLK
A0A075FFB0_BALF1-0      FVLGAIAHYLALYRRLWFARLGGMPRSLRRQFP----VTWALASLTDFLK
A0A075FCZ0_BALF1-0      FVLGAIAHYLALYRRLWFARLGGMPRSLKRQFP----VTWALASLTDFLK
A0A0C7T8J1_BALF1-0      FVLGAIAHYLALYRRLWFARLGGMPRSLRRQFP----VTWALASLTDFLK
A0A0C7TJ32_BALF1-0      FVLGAIAHYLALYRRLWFARLGGMPRSLRRQFP----VTWALASLTDFLK
A0A2D1LYV4_BALF1-0      FVLGAIAHYLALYRRLWFARLGGMPRSLRCQFP----VTWALASLTDFLK
K9UT94_BALF1-01         FVLGAIAHYLALYRRLWFARLGGMPRSLRRQFP----VTWALASLTDFLK
                                        *: . ** .  :  ::*    . *:*     ** 

A0A0S2YQS0_BHRF1-0      GLTLSLLVVCSYLFISRGRH
A0A2H4Z4F2_BHRF1-0      GLTLSLLVICSYLFISRGRH
A0A0C7U1E2_BHRF1-0      GLTLSLLVICSYLFISRGRH
V5KUE2_BHRF1-02         GLTLSLLVICSYLFISRGRH
A0A2H4Z4H8_BHRF1-0      GLTLSLLVICSYLFISRGRH
A0A2H4Z4E3_BHRF1-0      GLTLSLLVICSYLFISRGRH
A0A2H4Z4D9_BHRF1-0      GLTLSLLVICSYLFISRGRH
A0A0S2YRE8_BHRF1-0      GLTLSLLVICSYLFISRGRH
A0A0C7TWM2_BHRF1-0      GLTLSLLVICSYLFISRGRH
A0A2D1LYW3_BHRF1-0      GLTLSLLVICSYLFISRGRH
A0A0C7TTN2_BHRF1-0      GLTLSLLVICSYLFISRGRH
A0A0C7TQI4_BHRF1-0      GLTLSLLVICSYLFISRGRH
A0A2H4Z4I0_BHRF1-0      GLTLSLLVICSYLFISRGRH
A0A0C7TNT4_BHRF1-0      GLTLSLLVICSYLFISRGRH
A0A0C7TK05_BHRF1-0      GLTLSLLVICSYLFISRGRH
A0A0C7T924_BHRF1-0      GLTLSLLVICSYLFISRGRH
A0A0C7T306_BHRF1-0      GLTLSLLVICSYLFISRGRH
A0A0C7SXB3_BHRF1-0      GLTLSLLVICSYLFISRGRH
A0A0C7T6R4_BHRF1-0      GLTLSLLVICSYLFISRGRH
A0A0C7TX82_BHRF1-0      GLTLSLLVICSYLFISRGRH
A0A0X8YIW3_BHRF1-0      GLTLSLLVICSYLFISRGRH
A0A2H4Z4F8_BHRF1-0      GLTLSLLVICSYLFISRGRH
K9UTF7_BHRF1-01         GLTLSLLVICSYLFISRGRH
K9UTN7_BHRF1-01         GLTLSLLVICSYLFISRGRH
P03182_BHRF1-01         GLTLSLLVICSYLFISRGRH
P0C6Z1_BHRF1-01         GLTLSLLVICSYLFISRGRH
V5KU29_BHRF1-02         GLTLSLLVICSYLFISRGRQ
A0A2H4Z4C5_BHRF1-0      GLTLSLLVICSYLFISRGRH
A0A2H4Z4D6_BHRF1-0      GLTLSLLVICSYLFISRGRH
A0A0B6VHG4_BHRF1-0      GLTLSLLVICSYLFISRGRH
A0A0X9C4Q9_BHRF1-0      GLTLSLLVICSYLFISRGRH
A0A2H4Z4I4_BHRF1-0      GLTLSLLVICSYLFISRGRH
A0A2H4Z4M5_BHRF1-0      GLTLSLLVICSYLFISRGRH
G3CKQ0_BHRF1-01         GLTLSLLVICSYLFISRGRH
U5YUM6_BALF1-01         SL------------------
A0A0U3UKR9_BALF1-0      SL------------------
A0A0U3U737_BALF1-0      SL------------------
A0A0S2YQW9_BALF1-0      SL------------------
P0CK58_BALF1-01         SL------------------
P0CK59_BALF1-01         SL------------------
Q91HV2_BALF1-01         SL------------------
A0A0C7TV67_BALF1-0      SL------------------
A0A0C7TUX3_BALF1-0      SL------------------
A0A0C7TPI3_BALF1-0      SL------------------
A0A0C7TLW1_BALF1-0      SL------------------
A0A075FFB0_BALF1-0      SL------------------
A0A075FCZ0_BALF1-0      SL------------------
A0A0C7T8J1_BALF1-0      SL------------------
A0A0C7TJ32_BALF1-0      SL------------------
A0A2D1LYV4_BALF1-0      SL------------------
K9UT94_BALF1-01         SL------------------
                        .*                  

© 1998-2018