Dataset for protein herpesviridae of organism Epstein Barr virus

[Download (right click)] [Edit] [Sequences] [Repertoires]

95 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A0S2YQS0_BHRF1-0      --------------------MAHSTREILLALCIRDSRVHGNGVLHPVLE
A0A2H4Z4F2_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A451G617_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A410IGR6_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A3R5U6U7_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A3R5TSC7_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A385J922_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A385J8Q6_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A385J7D0_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2S1N3U3_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2S1MYK7_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2S1MX38_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2S1MWX4_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2S1MNB9_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2H4Z4I0_BHRF1-0      --------------------MAYSTRDILLALCIRDSRVHGNGALHPVLE
A0A3R5X5H4_BHRF1-0      --------------------MAYSTRDILLALCIRDSRVHGNGALHPVLE
A0A2H4Z4H8_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNASLHPVLE
A0A2H4Z4E3_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2H4Z4D9_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0C7U1E2_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0C7TWM2_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2D1LYW3_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0C7TNT4_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0C7TK05_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0C7T924_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0C7T306_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0C7SXB3_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A451G5Y6_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A410I865_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2H4Z4C5_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2S1MW70_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0B6VHG4_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0X9C4Q9_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2H4Z4I4_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGSLHPVLE
A0A2H4Z4M5_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGSLHPVLE
A0A2S1N164_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A3R5UEL7_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGALHPVLE
A0A2H4Z4D6_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2S1N3G0_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
V5KUE2_BHRF1-02         --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A385JAL1_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0S2YRE8_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
V5KU29_BHRF1-02         --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0C7T6R4_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0C7TX82_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A0X8YIW3_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A2H4Z4F8_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGILHPVLE
A0A2S1MMY2_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
P03182_BHRF1-01         --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
K9UTN7_BHRF1-01         --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
K9UTF7_BHRF1-01         --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A385J9R2_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A3R5TRD4_BHRF1-0      --------------------MAYSTREILLALCIRDSRVHGNGTLHPVLE
A0A385JAB4_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDAVFV
A0A2S1N1Z2_BALF1-0      MNRAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1N2H2_BALF1-0      MNRAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MZQ8_BALF1-0      MNLAITLDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A385J7X7_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MXY9_BALF1-0      MNLAIALDFPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MU91_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MQV1_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A0U3UKR9_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVNWPDETMRPAKSTDSVFV
A0A0U3U737_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A0S2YQW9_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRQAKSTDSVFV
A0A2S1MV59_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A0A8IKW4_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MM94_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MP06_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A2S1MTH2_BALF1-0      MNLAIALDSHHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A385J8K7_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
U5YUM6_BALF1-01         MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
Q91HV2_BALF1-01         MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
P0CK59_BALF1-01         MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A385JB67_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
P0CK58_BALF1-01         MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A410J0D8_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A410I9N0_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A410I1F1_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A3R5WKR1_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A0C7TUX3_BALF1-0      --------------------------------------MRQAKSTDSVFV
A0A0C7TPI3_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A0C7TLW1_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A0C7T5J4_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A0C7TV67_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A075FFB0_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A075FCZ0_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A0C7T546_BALF1-0      --------------------------------------MRPAKCTDSVFV
A0A0C7T8J1_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A0C7TJ32_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A2D1LYV4_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A3R5WNA2_BALF1-0      --------------------------------------MRPAKTTDSVFV
A0A3R5WV36_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A3R5WYW3_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A3R5ZJV6_BALF1-0      --------------------------------------MRPTKSTDSVFV
K9UT94_BALF1-01         --------------------------------------MRPAKSTDSVFV
                                                              :.      .*: 

A0A0S2YQS0_BHRF1-0      LAARETPPRVSPEDTVVLRYHVLLEEIIERNSDTFTETWDRFITHTEHLD
A0A2H4Z4F2_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
A0A451G617_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
A0A410IGR6_BHRF1-0      LAARETPLHLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
A0A3R5U6U7_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFMTHTEHLD
A0A3R5TSC7_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
A0A385J922_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A385J8Q6_BHRF1-0      LAARETPLCLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A385J7D0_BHRF1-0      LAARETLLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A2S1N3U3_BHRF1-0      LATRETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A2S1MYK7_BHRF1-0      LAARETPLCLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
A0A2S1MX38_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFLTHTEHLD
A0A2S1MWX4_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFTTHTEHLD
A0A2S1MNB9_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A2H4Z4I0_BHRF1-0      LAARETPPRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
A0A3R5X5H4_BHRF1-0      LAARETPPRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTENLD
A0A2H4Z4H8_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
A0A2H4Z4E3_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNSFITHTEHVD
A0A2H4Z4D9_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A0C7U1E2_BHRF1-0      LASRETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A0C7TWM2_BHRF1-0      LAARETPLRLLPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A2D1LYW3_BHRF1-0      LAARETPLRLLPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A0C7TNT4_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A0C7TK05_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A0C7T924_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A0C7T306_BHRF1-0      LAARETHLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A0C7SXB3_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A451G5Y6_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITYTEHLD
A0A410I865_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHMD
A0A2H4Z4C5_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTDHLD
A0A2S1MW70_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTGHLD
A0A0B6VHG4_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTENLD
A0A0X9C4Q9_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFIRHTEHLD
A0A2H4Z4I4_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
A0A2H4Z4M5_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
A0A2S1N164_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHLD
A0A3R5UEL7_BHRF1-0      LAARETPPRLSPEDTIVLRYHVLLEEIIERNSETFTETWNRFITHTENLD
A0A2H4Z4D6_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTANLD
A0A2S1N3G0_BHRF1-0      LASRETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
V5KUE2_BHRF1-02         LASRETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A385JAL1_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITYTEHVD
A0A0S2YRE8_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
V5KU29_BHRF1-02         LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A0C7T6R4_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFSETWNRFITHTEHVD
A0A0C7TX82_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A0X8YIW3_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A2H4Z4F8_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A2S1MMY2_BHRF1-0      LAARESPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
P03182_BHRF1-01         LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
K9UTN7_BHRF1-01         LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
K9UTF7_BHRF1-01         LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A385J9R2_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A3R5TRD4_BHRF1-0      LAARETPLRLSPEDTVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVD
A0A385JAB4_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A2S1N1Z2_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFARDEK--D
A0A2S1N2H2_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFARDEK--D
A0A2S1MZQ8_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFARDEK--D
A0A385J7X7_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFARDEK--D
A0A2S1MXY9_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A2S1MU91_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A2S1MQV1_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A0U3UKR9_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A0U3U737_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A0S2YQW9_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A2S1MV59_BALF1-0      RTPVEAWVAPLPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A0A8IKW4_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A2S1MM94_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A2S1MP06_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A2S1MTH2_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A385J8K7_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--N
U5YUM6_BALF1-01         KTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
Q91HV2_BALF1-01         RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
P0CK59_BALF1-01         RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A385JB67_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
P0CK58_BALF1-01         RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A410J0D8_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A410I9N0_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A410I1F1_BALF1-0      KTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A3R5WKR1_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDET--D
A0A0C7TUX3_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A0C7TPI3_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A0C7TLW1_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A0C7T5J4_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFARDEK--D
A0A0C7TV67_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFARDEK--D
A0A075FFB0_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A075FCZ0_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A0C7T546_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A0C7T8J1_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A0C7TJ32_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A2D1LYV4_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A3R5WNA2_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A3R5WV36_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
A0A3R5WYW3_BALF1-0      RTPVEAWVAPSPPD----------DRVAESSYLMFRAMYAVFTRDEK--D
A0A3R5ZJV6_BALF1-0      RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
K9UT94_BALF1-01         RTPVEAWVAPSPPD----------DKVAESSYLMFRAMYAVFTRDEK--D
                         :. *:     * *          : : * .   *   :  *       :

A0A0S2YQS0_BHRF1-0      LDFNSIFLEIFHRGDPSRGRALAWLAWCMHACRTLCCNQDTPY-------
A0A2H4Z4F2_BHRF1-0      LDFNSVFLEIFHRGDPSLGCALTWMAWGMHACWTLCCNQSTPY-------
A0A451G617_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A410IGR6_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A3R5U6U7_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A3R5TSC7_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCSNQSTPY-------
A0A385J922_BHRF1-0      LDFNSVFVEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A385J8Q6_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A385J7D0_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A2S1N3U3_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A2S1MYK7_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A2S1MX38_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A2S1MWX4_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A2S1MNB9_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A2H4Z4I0_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A3R5X5H4_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A2H4Z4H8_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A2H4Z4E3_BHRF1-0      LDFNSVFVEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A2H4Z4D9_BHRF1-0      LDFNSVFVEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A0C7U1E2_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCYNQSTPY-------
A0A0C7TWM2_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A2D1LYW3_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRRLCCNQSTPY-------
A0A0C7TNT4_BHRF1-0      LDFNSVFLEIFHRGDPSLGRTLAWMAWCMHACRTLCCNQSTPY-------
A0A0C7TK05_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNPSTPY-------
A0A0C7T924_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A0C7T306_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A0C7SXB3_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCFNQSTPY-------
A0A451G5Y6_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A410I865_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A2H4Z4C5_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A2S1MW70_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A0B6VHG4_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQYTPY-------
A0A0X9C4Q9_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A2H4Z4I4_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A2H4Z4M5_BHRF1-0      LDFNSVFFEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A2S1N164_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A3R5UEL7_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQYTPY-------
A0A2H4Z4D6_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQYTPY-------
A0A2S1N3G0_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
V5KUE2_BHRF1-02         LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A385JAL1_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A0S2YRE8_BHRF1-0      LDFNSVFLEIFHRGDPRLGRALAWMAWCMHACRTLCCNQSTPY-------
V5KU29_BHRF1-02         LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A0C7T6R4_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A0C7TX82_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMYACRTLCCNQSTPY-------
A0A0X8YIW3_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRALCCNQSTPY-------
A0A2H4Z4F8_BHRF1-0      LDFNSVFVEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A2S1MMY2_BHRF1-0      LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
P03182_BHRF1-01         LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
K9UTN7_BHRF1-01         LDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
K9UTF7_BHRF1-01         LDFNSVFVEIFHRGDPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A385J9R2_BHRF1-0      LDFNSVFLEIFHRGXPSLGRALAWMAWCMHACRTLCCNQSTPY-------
A0A3R5TRD4_BHRF1-0      LDFNSVFVEIFHRGDPSLGRALAWMAWCMHACRTLCCNQCTPY-------
A0A385JAB4_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
A0A2S1N1Z2_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YTELACRTADIGGKDTHVRLIISV
A0A2S1N2H2_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
A0A2S1MZQ8_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
A0A385J7X7_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
A0A2S1MXY9_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
A0A2S1MU91_BALF1-0      LPLPALVLCRLIKASLRKDREL----YAELACRTADIGGKDTHVRLIISV
A0A2S1MQV1_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADVGGKDTHVRLIISV
A0A0U3UKR9_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIRGKDTHVRLIISV
A0A0U3U737_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGDKDTHVRLIISV
A0A0S2YQW9_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
A0A2S1MV59_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
A0A0A8IKW4_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
A0A2S1MM94_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
A0A2S1MP06_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRIIISV
A0A2S1MTH2_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
A0A385J8K7_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
U5YUM6_BALF1-01         LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
Q91HV2_BALF1-01         LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
P0CK59_BALF1-01         LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
A0A385JB67_BALF1-0      LPLPALVLCRXXKAXLRKDRKL----YAELACRTADIGGKDTHVRLIISV
P0CK58_BALF1-01         LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
A0A410J0D8_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
A0A410I9N0_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
A0A410I1F1_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
A0A3R5WKR1_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
A0A0C7TUX3_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
A0A0C7TPI3_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADVGGKDTHVRLIISV
A0A0C7TLW1_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YADLACRTADIGGKDTHVRLIISV
A0A0C7T5J4_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
A0A0C7TV67_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
A0A075FFB0_BALF1-0      LPLPALVLCRLIKASLRKDRRL----YAELACRTADIGGKDTHVRLIISV
A0A075FCZ0_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
A0A0C7T546_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
A0A0C7T8J1_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRIIISV
A0A0C7TJ32_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
A0A2D1LYV4_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
A0A3R5WNA2_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
A0A3R5WV36_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISI
A0A3R5WYW3_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
A0A3R5ZJV6_BALF1-0      LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
K9UT94_BALF1-01         LPLPALVLCRLIKASLRKDRKL----YAELACRTADIGGKDTHVRLIISV
                        * : ::..    ..    .  *    :   **.        .:       

A0A0S2YQS0_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A2H4Z4F2_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A451G617_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A410IGR6_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A3R5U6U7_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A3R5TSC7_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A385J922_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A385J8Q6_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A385J7D0_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A2S1N3U3_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A2S1MYK7_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A2S1MX38_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A2S1MWX4_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A2S1MNB9_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A2H4Z4I0_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A3R5X5H4_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A2H4Z4H8_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A2H4Z4E3_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A2H4Z4D9_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A0C7U1E2_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A0C7TWM2_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A2D1LYW3_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A0C7TNT4_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A0C7TK05_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A0C7T924_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A0C7T306_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A0C7SXB3_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A451G5Y6_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A410I865_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A2H4Z4C5_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A2S1MW70_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A0B6VHG4_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A0X9C4Q9_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A2H4Z4I4_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A2H4Z4M5_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A2S1N164_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A3R5UEL7_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A2H4Z4D6_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A2S1N3G0_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
V5KUE2_BHRF1-02         --------------------YVVDLSVRGMLEASEGLD------------
A0A385JAL1_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A0S2YRE8_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
V5KU29_BHRF1-02         --------------------YVVDLSVRGMLEASEGLD------------
A0A0C7T6R4_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A0C7TX82_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A0X8YIW3_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A2H4Z4F8_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A2S1MMY2_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
P03182_BHRF1-01         --------------------YVVDLSVRGMLEASEGLD------------
K9UTN7_BHRF1-01         --------------------YVVDLSVRGMLEASEGLD------------
K9UTF7_BHRF1-01         --------------------YVVDLSVRGMLEASEGLD------------
A0A385J9R2_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A3R5TRD4_BHRF1-0      --------------------YVVDLSVRGMLEASEGLD------------
A0A385JAB4_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A2S1N1Z2_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A2S1N2H2_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A2S1MZQ8_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A385J7X7_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A2S1MXY9_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A2S1MU91_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A2S1MQV1_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A0U3UKR9_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A0U3U737_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A0S2YQW9_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A2S1MV59_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A0A8IKW4_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A2S1MM94_BALF1-0      LRALYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A2S1MP06_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A2S1MTH2_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A385J8K7_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
U5YUM6_BALF1-01         LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
Q91HV2_BALF1-01         LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
P0CK59_BALF1-01         LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A385JB67_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
P0CK58_BALF1-01         LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A410J0D8_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A410I9N0_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A410I1F1_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A3R5WKR1_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A0C7TUX3_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A0C7TPI3_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A0C7TLW1_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A0C7T5J4_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A0C7TV67_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A075FFB0_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A075FCZ0_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A0C7T546_BALF1-0      LRALYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A0C7T8J1_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A0C7TJ32_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLNDHKSAAFVLGAIAHYLAL
A0A2D1LYV4_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A3R5WNA2_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A3R5WV36_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A3R5WYW3_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
A0A3R5ZJV6_BALF1-0      LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
K9UT94_BALF1-01         LRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLAL
                                            *.* ::**. *:  :.              

A0A0S2YQS0_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRSFSWTLFLAGLTLSLLVVCSYLFISR
A0A2H4Z4F2_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A451G617_BHRF1-0      ---GWIHQQGGWTTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A410IGR6_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A3R5U6U7_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A3R5TSC7_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A385J922_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRSFSWTLFLAGLTLSLLVICSYLFISR
A0A385J8Q6_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A385J7D0_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A2S1N3U3_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A2S1MYK7_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A2S1MX38_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A2S1MWX4_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A2S1MNB9_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGYRRFSWTLFLAGLTLSLLVICSYLFISR
A0A2H4Z4I0_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A3R5X5H4_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A2H4Z4H8_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A2H4Z4E3_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A2H4Z4D9_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFIWTLFLAGLTLSLLVICSYLFISR
A0A0C7U1E2_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A0C7TWM2_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A2D1LYW3_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A0C7TNT4_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A0C7TK05_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A0C7T924_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRKFSWTLFLAGLTLSLLVICSYLFISR
A0A0C7T306_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A0C7SXB3_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A451G5Y6_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A410I865_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A2H4Z4C5_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A2S1MW70_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A0B6VHG4_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A0X9C4Q9_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A2H4Z4I4_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A2H4Z4M5_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A2S1N164_BHRF1-0      ---GWIHQQGGWSTLIEDNFPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A3R5UEL7_BHRF1-0      ---GWIHQQGGWSTLIENNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A2H4Z4D6_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A2S1N3G0_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
V5KUE2_BHRF1-02         ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A385JAL1_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A0S2YRE8_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
V5KU29_BHRF1-02         ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A0C7T6R4_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A0C7TX82_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A0X8YIW3_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A2H4Z4F8_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A2S1MMY2_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
P03182_BHRF1-01         ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
K9UTN7_BHRF1-01         ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
K9UTF7_BHRF1-01         ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A385J9R2_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A3R5TRD4_BHRF1-0      ---GWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVICSYLFISR
A0A385JAB4_BALF1-0      YRRLWFARLGGMPRSLR------RQFPVTWALASLTDFLKSL--------
A0A2S1N1Z2_BALF1-0      YRRLWFARLGGMPRSLR------RQFPVTWALASLTDFLKSL--------
A0A2S1N2H2_BALF1-0      YRRLWFARLGGMPRSLR------RQFPVTWALASLTDFLKSL--------
A0A2S1MZQ8_BALF1-0      YRRLWFARLGGMPRSLR------RQFPVTWALASLTDFLKSL--------
A0A385J7X7_BALF1-0      YRRLWFARLGGMPRSLR------RQFPVTWALASLTDFLKSL--------
A0A2S1MXY9_BALF1-0      YRRPWFARLGGMPRSLR------RQFPVTWALASLTDFLKSL--------
A0A2S1MU91_BALF1-0      YRRLWFARLGGMPRSLR------RQFPVTWALASLTDFLKSL--------
A0A2S1MQV1_BALF1-0      YRRLWFARLGGMPRSLR------RQFPVTWALASLTDFLKSL--------
A0A0U3UKR9_BALF1-0      YRRLWFARLGGMPRSLR------RQFPVTWALASLTDFLKSL--------
A0A0U3U737_BALF1-0      YRRLWFARLGGMPRSLR------RQFPVTWALASLTDFLKSL--------
A0A0S2YQW9_BALF1-0      YRRLWFARLGGMPRSLR------RQFPVTWALASLTDFLKSL--------
A0A2S1MV59_BALF1-0      YRRLWFARLGGMPRSLR------RQFPVTWALASLTDFLKSL--------
A0A0A8IKW4_BALF1-0      YRRLWFARLGGMPRSLR------RQFPVTWALASLTDFLKSL--------
A0A2S1MM94_BALF1-0      YRRLWFARLGGMPRSLR------RQFPVTWALASLTDFLKSL--------
A0A2S1MP06_BALF1-0      YRRLWFARLGGMPRSLR------RQFPVTWALASLTDFLKSL--------
A0A2S1MTH2_BALF1-0      YRRLWFARLGGMPRSLR------RQFPVTWALASLTDFLKSL--------
A0A385J8K7_BALF1-0      YRRLWFARLGGMPRSLR------RQFPVTWALASLTDFLKSL--------
U5YUM6_BALF1-01         YRRLWFARLGGMPRSLR------RQFPVTWALASLTDFLKSL--------
Q91HV2_BALF1-01         YRRLWFARLGGMPRSLR------CQFPVTWALASLTDFLKSL--------
P0CK59_BALF1-01         YRRLWFARLGGMPRSLR------RQFPVTWALASLTDFLKSL--------
A0A385JB67_BALF1-0      YRRLWFARLGGMPRSLR------RQFPVTWALASLTDFLKSL--------
P0CK58_BALF1-01         YRRLWFARLGGMPRSLR------RQFPVTWALASLTDFLKSL--------
A0A410J0D8_BALF1-0      YRRLWFVRLGGMPRSLR------RQFPVTWALASLTDFLKSL--------
A0A410I9N0_BALF1-0      YRRLWFARLGGMPRSLR------RQFPVTWTLASLTDFLKSL--------
A0A410I1F1_BALF1-0      YRRLWFARLGGMPRSLR------RQFPVTWALASLTDFLKSL--------
A0A3R5WKR1_BALF1-0      YRRLWFARLGGMPRSLR------RQFPVTWALASLTDFLKSL--------
A0A0C7TUX3_BALF1-0      YRRLWFARLGGMPRSLR------RQFPVTWALASLTDFLKSL--------
A0A0C7TPI3_BALF1-0      YRRLWFARLGGMPRSLR------RQFPVTWALASLTDFLKSL--------
A0A0C7TLW1_BALF1-0      YRRLWFARLGGMPRSLR------RQFPVTWALASLTDFLKSL--------
A0A0C7T5J4_BALF1-0      YRRLWFARLGGMPRSLR------RQFPVTWALASLTDFLKSL--------
A0A0C7TV67_BALF1-0      YRRIWFARLGGMPRSLR------RQFPVTWALASLTDFLKSL--------
A0A075FFB0_BALF1-0      YRRLWFARLGGMPRSLR------RQFPVTWALASLTDFLKSL--------
A0A075FCZ0_BALF1-0      YRRLWFARLGGMPRSLK------RQFPVTWALASLTDFLKSL--------
A0A0C7T546_BALF1-0      YRRLWFARLGGMPRSLR------RQFPVTWALASLTDFLKSL--------
A0A0C7T8J1_BALF1-0      YRRLWFARLGGMPRSLR------RQFPVTWALASLTDFLKSL--------
A0A0C7TJ32_BALF1-0      YRRLWFARLGGMPRSLR------RQFPVTWALASLTDFLKSL--------
A0A2D1LYV4_BALF1-0      YRRLWFARLGGMPRSLR------CQFPVTWALASLTDFLKSL--------
A0A3R5WNA2_BALF1-0      YRRLWFARLGGMPRSLR------RQFPVTWALASLTDFLKSL--------
A0A3R5WV36_BALF1-0      YRRLWFARLGGMPRSLR------RQFPVTWALASLTDFLKSL--------
A0A3R5WYW3_BALF1-0      YRRLWFARLGGMPRSLR------RQFPVTWALASLTDFLKSL--------
A0A3R5ZJV6_BALF1-0      YRRLWFARLGGMPRSLR------RQFPVTWALASLTDFLKSL--------
K9UT94_BALF1-01         YRRLWFARLGGMPRSLR------RQFPVTWALASLTDFLKSL--------
                            *: . ** .  :         *  *  **.**  *  :        

A0A0S2YQS0_BHRF1-0      GRH
A0A2H4Z4F2_BHRF1-0      GRH
A0A451G617_BHRF1-0      GRH
A0A410IGR6_BHRF1-0      GRH
A0A3R5U6U7_BHRF1-0      GRH
A0A3R5TSC7_BHRF1-0      GRH
A0A385J922_BHRF1-0      GRH
A0A385J8Q6_BHRF1-0      GRH
A0A385J7D0_BHRF1-0      GRH
A0A2S1N3U3_BHRF1-0      GRH
A0A2S1MYK7_BHRF1-0      GRH
A0A2S1MX38_BHRF1-0      GRH
A0A2S1MWX4_BHRF1-0      GRH
A0A2S1MNB9_BHRF1-0      GRH
A0A2H4Z4I0_BHRF1-0      GRH
A0A3R5X5H4_BHRF1-0      GRH
A0A2H4Z4H8_BHRF1-0      GRH
A0A2H4Z4E3_BHRF1-0      GRH
A0A2H4Z4D9_BHRF1-0      GRH
A0A0C7U1E2_BHRF1-0      GRH
A0A0C7TWM2_BHRF1-0      GRH
A0A2D1LYW3_BHRF1-0      GRH
A0A0C7TNT4_BHRF1-0      GRH
A0A0C7TK05_BHRF1-0      GRH
A0A0C7T924_BHRF1-0      GRH
A0A0C7T306_BHRF1-0      GRH
A0A0C7SXB3_BHRF1-0      GRH
A0A451G5Y6_BHRF1-0      GRH
A0A410I865_BHRF1-0      GRH
A0A2H4Z4C5_BHRF1-0      GRH
A0A2S1MW70_BHRF1-0      GRH
A0A0B6VHG4_BHRF1-0      GRH
A0A0X9C4Q9_BHRF1-0      GRH
A0A2H4Z4I4_BHRF1-0      GRH
A0A2H4Z4M5_BHRF1-0      GRH
A0A2S1N164_BHRF1-0      GRH
A0A3R5UEL7_BHRF1-0      GRH
A0A2H4Z4D6_BHRF1-0      GRH
A0A2S1N3G0_BHRF1-0      GRQ
V5KUE2_BHRF1-02         GRH
A0A385JAL1_BHRF1-0      GRH
A0A0S2YRE8_BHRF1-0      GRH
V5KU29_BHRF1-02         GRQ
A0A0C7T6R4_BHRF1-0      GRH
A0A0C7TX82_BHRF1-0      GRH
A0A0X8YIW3_BHRF1-0      GRH
A0A2H4Z4F8_BHRF1-0      GRH
A0A2S1MMY2_BHRF1-0      GRH
P03182_BHRF1-01         GRH
K9UTN7_BHRF1-01         GRH
K9UTF7_BHRF1-01         GRH
A0A385J9R2_BHRF1-0      GRH
A0A3R5TRD4_BHRF1-0      GRH
A0A385JAB4_BALF1-0      ---
A0A2S1N1Z2_BALF1-0      ---
A0A2S1N2H2_BALF1-0      ---
A0A2S1MZQ8_BALF1-0      ---
A0A385J7X7_BALF1-0      ---
A0A2S1MXY9_BALF1-0      ---
A0A2S1MU91_BALF1-0      ---
A0A2S1MQV1_BALF1-0      ---
A0A0U3UKR9_BALF1-0      ---
A0A0U3U737_BALF1-0      ---
A0A0S2YQW9_BALF1-0      ---
A0A2S1MV59_BALF1-0      ---
A0A0A8IKW4_BALF1-0      ---
A0A2S1MM94_BALF1-0      ---
A0A2S1MP06_BALF1-0      ---
A0A2S1MTH2_BALF1-0      ---
A0A385J8K7_BALF1-0      ---
U5YUM6_BALF1-01         ---
Q91HV2_BALF1-01         ---
P0CK59_BALF1-01         ---
A0A385JB67_BALF1-0      ---
P0CK58_BALF1-01         ---
A0A410J0D8_BALF1-0      ---
A0A410I9N0_BALF1-0      ---
A0A410I1F1_BALF1-0      ---
A0A3R5WKR1_BALF1-0      ---
A0A0C7TUX3_BALF1-0      ---
A0A0C7TPI3_BALF1-0      ---
A0A0C7TLW1_BALF1-0      ---
A0A0C7T5J4_BALF1-0      ---
A0A0C7TV67_BALF1-0      ---
A0A075FFB0_BALF1-0      ---
A0A075FCZ0_BALF1-0      ---
A0A0C7T546_BALF1-0      ---
A0A0C7T8J1_BALF1-0      ---
A0A0C7TJ32_BALF1-0      ---
A0A2D1LYV4_BALF1-0      ---
A0A3R5WNA2_BALF1-0      ---
A0A3R5WV36_BALF1-0      ---
A0A3R5WYW3_BALF1-0      ---
A0A3R5ZJV6_BALF1-0      ---
K9UT94_BALF1-01         ---
                           

© 1998-2019