Dataset for protein BALF1 of organism Epstein Barr virus

[Download (right click)] [Edit] [Sequences] [Repertoires]

17 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


U5YUM6_BALF1-01         MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A0U3UKR9_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVNWPDETMRPAKSTDSVFV
A0A0U3U737_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A0S2YQW9_BALF1-0      MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRQAKSTDSVFV
P0CK58_BALF1-01         MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
P0CK59_BALF1-01         MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
Q91HV2_BALF1-01         MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFV
A0A0C7TV67_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A0C7TUX3_BALF1-0      --------------------------------------MRQAKSTDSVFV
A0A0C7TPI3_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A0C7TLW1_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A075FFB0_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A075FCZ0_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A0C7T8J1_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A0C7TJ32_BALF1-0      --------------------------------------MRPAKSTDSVFV
A0A2D1LYV4_BALF1-0      --------------------------------------MRPAKSTDSVFV
K9UT94_BALF1-01         --------------------------------------MRPAKSTDSVFV
                                                              ** *********

U5YUM6_BALF1-01         KTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
A0A0U3UKR9_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
A0A0U3U737_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
A0A0S2YQW9_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
P0CK58_BALF1-01         RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
P0CK59_BALF1-01         RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
Q91HV2_BALF1-01         RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
A0A0C7TV67_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFARDEKDLPLPALVLCRLI
A0A0C7TUX3_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
A0A0C7TPI3_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
A0A0C7TLW1_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
A0A075FFB0_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
A0A075FCZ0_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
A0A0C7T8J1_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
A0A0C7TJ32_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
A0A2D1LYV4_BALF1-0      RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
K9UT94_BALF1-01         RTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
                        .*******************************:*****************

U5YUM6_BALF1-01         KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A0U3UKR9_BALF1-0      KASLRKDRKLYAELACRTADIRGKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A0U3U737_BALF1-0      KASLRKDRKLYAELACRTADIGDKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A0S2YQW9_BALF1-0      KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
P0CK58_BALF1-01         KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
P0CK59_BALF1-01         KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
Q91HV2_BALF1-01         KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A0C7TV67_BALF1-0      KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A0C7TUX3_BALF1-0      KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A0C7TPI3_BALF1-0      KASLRKDRKLYAELACRTADVGGKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A0C7TLW1_BALF1-0      KASLRKDRKLYADLACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A075FFB0_BALF1-0      KASLRKDRRLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A075FCZ0_BALF1-0      KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A0C7T8J1_BALF1-0      KASLRKDRKLYAELACRTADIGGKDTHVRIIISVLRAVYNDHYDYWSRLR
A0A0C7TJ32_BALF1-0      KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
A0A2D1LYV4_BALF1-0      KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
K9UT94_BALF1-01         KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLR
                        ********.***:*******: .******:********************

U5YUM6_BALF1-01         VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A0U3UKR9_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A0U3U737_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A0S2YQW9_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
P0CK58_BALF1-01         VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
P0CK59_BALF1-01         VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
Q91HV2_BALF1-01         VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A0C7TV67_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRIWFARLGGMPRSL
A0A0C7TUX3_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A0C7TPI3_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A0C7TLW1_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A075FFB0_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A075FCZ0_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A0C7T8J1_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A0C7TJ32_BALF1-0      VVLCYTVVFAVRNYLNDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
A0A2D1LYV4_BALF1-0      VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
K9UT94_BALF1-01         VVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
                        ***************:*********************:************

U5YUM6_BALF1-01         RRQFPVTWALASLTDFLKSL
A0A0U3UKR9_BALF1-0      RRQFPVTWALASLTDFLKSL
A0A0U3U737_BALF1-0      RRQFPVTWALASLTDFLKSL
A0A0S2YQW9_BALF1-0      RRQFPVTWALASLTDFLKSL
P0CK58_BALF1-01         RRQFPVTWALASLTDFLKSL
P0CK59_BALF1-01         RRQFPVTWALASLTDFLKSL
Q91HV2_BALF1-01         RCQFPVTWALASLTDFLKSL
A0A0C7TV67_BALF1-0      RRQFPVTWALASLTDFLKSL
A0A0C7TUX3_BALF1-0      RRQFPVTWALASLTDFLKSL
A0A0C7TPI3_BALF1-0      RRQFPVTWALASLTDFLKSL
A0A0C7TLW1_BALF1-0      RRQFPVTWALASLTDFLKSL
A0A075FFB0_BALF1-0      RRQFPVTWALASLTDFLKSL
A0A075FCZ0_BALF1-0      KRQFPVTWALASLTDFLKSL
A0A0C7T8J1_BALF1-0      RRQFPVTWALASLTDFLKSL
A0A0C7TJ32_BALF1-0      RRQFPVTWALASLTDFLKSL
A0A2D1LYV4_BALF1-0      RCQFPVTWALASLTDFLKSL
K9UT94_BALF1-01         RRQFPVTWALASLTDFLKSL
                        . ******************

© 1998-2018