Dataset for protein herpesviridae of organism Cercopithecine herpesvirus 12

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q9Q5K8_BHRF1-01      MAYSTRDLLLALCMRDGHVYGGDGLHPVLELTARESPFSVSPGDPLVLRL
Q9WGB5_BHRF1-01      MAYSTRDLLLALCMRDGHVYGGDGLHPVLELTARESPFSVSPGDPLVLRL
Q99F66_BALF1-01      ------------------MKAAKSTDSVFVRTPVEAWVSPSPPDDKVAET
                                       : ....  .*:  *. *: .* ** *  *   

Q9Q5K8_BHRF1-01      HALLEQ---IIVQNEDAFAETLVTFLLNTEDLDLDFSRVFAEIFHNEDPT
Q9WGB5_BHRF1-01      HALLEQ---IIVQNEDAFAETLDRFLLNTEDLDLDFSRVFAEIFHNEDPT
Q99F66_BALF1-01      SYLLFRAMYAVFTQDETDLPTPAQVLCRLIKASLRKDKKLYAELACKTAD
                       ** .    :. ::::   *   .* .  . .*  .. :   :  : . 

Q9Q5K8_BHRF1-01      LGRGLAWLAWCMHACRTLCGDTN--------CPYYVVDLAVRGMLEASEG
Q9WGB5_BHRF1-01      LGRGLAWLAWCMHACRTLCGDTN--------CPYYVVDLAVRGMLEASEG
Q99F66_BALF1-01      IGGKHAHVQLIISILRAVYDDHYDYWSRLRVVLCYAVVFAVRNYLDDHES
                     :*   *.:   :   *:: .*             *.* :***. *:  *.

Q9Q5K8_BHRF1-01      LD---------------GWIGQHGGWPAVLRGNPSGTRSSRWTIVFTGLT
Q9WGB5_BHRF1-01      LD---------------GWIGQHGGWPAVLRGNPSGTRSSRWTIVFTGLT
Q99F66_BALF1-01      AAFVLGATAHYLALYRRVWFARIGGLPRSLRRQFPVT----WAIASLSDF
                                       *:.. ** *  ** : . *    *:*.  .  

Q9Q5K8_BHRF1-01      LSLLVVCSYIFISRRH
Q9WGB5_BHRF1-01      LSLLVVCSYIFISRRH
Q99F66_BALF1-01      LKSL------------
                     *. *            

© 1998-2018