Dataset for protein BHRF1 of organism Cercopithecine herpesvirus 12

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q9Q5K8_BHRF1-01      MAYSTRDLLLALCMRDGHVYGGDGLHPVLELTARESPFSVSPGDPLVLRL
Q9WGB5_BHRF1-01      MAYSTRDLLLALCMRDGHVYGGDGLHPVLELTARESPFSVSPGDPLVLRL
                     **************************************************

Q9Q5K8_BHRF1-01      HALLEQIIVQNEDAFAETLVTFLLNTEDLDLDFSRVFAEIFHNEDPTLGR
Q9WGB5_BHRF1-01      HALLEQIIVQNEDAFAETLDRFLLNTEDLDLDFSRVFAEIFHNEDPTLGR
                     *******************  *****************************

Q9Q5K8_BHRF1-01      GLAWLAWCMHACRTLCGDTNCPYYVVDLAVRGMLEASEGLDGWIGQHGGW
Q9WGB5_BHRF1-01      GLAWLAWCMHACRTLCGDTNCPYYVVDLAVRGMLEASEGLDGWIGQHGGW
                     **************************************************

Q9Q5K8_BHRF1-01      PAVLRGNPSGTRSSRWTIVFTGLTLSLLVVCSYIFISRRH
Q9WGB5_BHRF1-01      PAVLRGNPSGTRSSRWTIVFTGLTLSLLVVCSYIFISRRH
                     ****************************************

© 1998-2018