Dataset for protein herpesviridae of organism Bovine herpesvirus 4

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q1XBS6_VBCL2-01      MSLFFVVWYWVNYITKVCSGEVYIPSVLKFQYHSDTEHEPYSNLCENLIT
Q1XBS8_VBCL2-01      MSLFFIVWYWVNYITKVCSGEVYIPSVLKFQYHSDTEHEPYSNLCENLIT
Q1XBS7_VBCL2-01      MSLFFVVWYWVNYITKVCSGEVYIPSVLKFQYHSDTEHEPYSNLCENLIT
Q99D15_VBCL2-01      MSLFFVVWYWVNYITKVCFGEVYIPSVLKFQYHSDTEHEPYSNLCKNLIT
Q9WH78_VBCL2-01      MSLFFVVWYWVNYITKVCSGEVYIPSVLKFQYHSDTEHEPYSNLCKNLIT
                     *****:************ **************************:****

Q1XBS6_VBCL2-01      MAEQDMDEVVSTIRRLLVECGMGLEEYLDHPVTAPIKVAVQDVIRTKQDI
Q1XBS8_VBCL2-01      MAEQDMDEVVSTIRRLLVECGMGLEEYLDHPVTAPIKVAVQDVIRTKQDI
Q1XBS7_VBCL2-01      MAEQDMDEVVSTIRRLLVECGMGLEEYLEHPVTAPIKVAVQDVIRTKQDI
Q99D15_VBCL2-01      MAEQDMDEVVSTIRRLLVECGMGLEEYLEHPVTAPIKVAVQDVIRTKQDI
Q9WH78_VBCL2-01      MAEQDMDEVVSTIRRLLVECGMGLEEYLEHPVTAPIKVAVQDVIRTKQDI
                     ****************************:*********************

Q1XBS6_VBCL2-01      FSNFLTNINSVEDLETLGHAITTLNDYPSPNMGRVVCGIAFSVYVVQTVC
Q1XBS8_VBCL2-01      FSNFLTNINSVEDLETLGHAITTLNDYPSPNMGRVVCGIAFSVYVVQTVC
Q1XBS7_VBCL2-01      FSNFLTNINSVEDLETLGHAITTLNDYPSPNMGRVVCGIAFSVYVVQTVC
Q99D15_VBCL2-01      FSNFLTNINSVEDLETLGHAITTLNDYPSPNMGRVVCGIAFSVYVVQTVC
Q9WH78_VBCL2-01      FSNFLTNINSVEDLETLGHAITTLNDYPSPNMGRVVCGIAFSVYVVQTVC
                     **************************************************

Q1XBS6_VBCL2-01      KRKPLLVRCCLDIFTRATVQALNVNWFLQEGGWPALASFCKVVNSPSPRS
Q1XBS8_VBCL2-01      KRKPLLVRCCLDIFTRATVQALNVNWFLQEGGWPALASFCKVVNSPSPRS
Q1XBS7_VBCL2-01      KRKPLLVRCCLDIFTRATVQALNVNWFLQEGGWPALASFCKVVNSPSPRS
Q99D15_VBCL2-01      KRKPLLVRCCLDIFTRATVQALNVNWFLQEGGWPALASFCKVVNSPSPRS
Q9WH78_VBCL2-01      KRKPLLVRCCLDIFTRATVQALNVNWFLQEGGWPALASFCKVVNSPSPRS
                     **************************************************

Q1XBS6_VBCL2-01      RWLFPMLAISGLVLTVGVARNMVHFT
Q1XBS8_VBCL2-01      RWLFPMLAISGLVLTVGVARNMVHFT
Q1XBS7_VBCL2-01      RWLFPMLAISGLVLTVGVARNMVHFT
Q99D15_VBCL2-01      RWLFPMFAISGLVLTVGVARNMVHFT
Q9WH78_VBCL2-01      RWLFPMFAISGLVLTVGVARNMVHFT
                     ******:*******************

© 1998-2018