Dataset for protein E1B 19K of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

223 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q71BY5_E1B19K-01        --------------------------------------------------
A0A384ZUF2_E1B19K-      MEPGHPTEQGLHPGLRSHAPVEGLDQAAGTENLELLASTASSSGSSSSTQ
A0A384ZUM9_E1B19K-      MEPGHPTEQGLHPGLRSHAPVEGLDQAAGTENLELLASTASSSGSSSSTQ
A0A0M4NHE0_E1B19K-      ----------------------------------------------MINC
H9AAK5_E1B19K-01        ----------------------------------------------MING
G0ZAH2_E1B19K-01        --------------------------------------------------
A0A1W5PVU4_E1B19K-      --------------------------------------------------
A0A0M3TH18_E1B19K-      --------------------------------------------------
A0A097IW62_E1B19K-      --------------------------------------------------
A0A0A1EUE4_E1B19K-      --------------------------------------------------
A0A2H5AI40_E1B19K-      --------------------------------------------------
A0A2H5AID8_E1B19K-      --------------------------------------------------
A0A2H5AII9_E1B19K-      --------------------------------------------------
A0A2H5AIL0_E1B19K-      --------------------------------------------------
A0A2H5AIN5_E1B19K-      --------------------------------------------------
A0A2H5AIS9_E1B19K-      --------------------------------------------------
A0A2H5AIT6_E1B19K-      --------------------------------------------------
A0A2H5AIU0_E1B19K-      --------------------------------------------------
A0A2H5AIC5_E1B19K-      --------------------------------------------------
D3JIR7_E1B19K-01        --------------------------------------------------
A0A076V686_E1B19K-      --------------------------------------------------
P04492_E1B19K-01        --------------------------------------------------
G1DE13_E1B19K-01        --------------------------------------------------
D0Z5R9_E1B19K-01        --------------------------------------------------
T1UEX7_E1B19K-01        --------------------------------------------------
A0A2H5AI99_E1B19K-      --------------------------------------------------
A0A0M3TH31_E1B19K-      --------------------------------------------------
M9YXY5_E1B19K-01        --------------------------------------------------
M9YVF6_E1B19K-01        --------------------------------------------------
A0MK43_E1B19K-01        --------------------------------------------------
A0A2H5AI21_E1B19K-      --------------------------------------------------
A0A0M5L3Y4_E1B19K-      --------------------------------------------------
Q5C8R2_E1B19K-01        --------------------------------------------------
A0A0A1EUB2_E1B19K-      --------------------------------------------------
A0A0A1EUC8_E1B19K-      --------------------------------------------------
A0A2H5AI04_E1B19K-      --------------------------------------------------
A0A2H5AI72_E1B19K-      --------------------------------------------------
A0A2H5AIL3_E1B19K-      --------------------------------------------------
A0A2H4CJZ0_E1B19K-      --------------------------------------------------
H8PFZ1_E1B19K-01        --------------------------------------------------
F4ZCJ8_E1B19K-01        --------------------------------------------------
A0A1S6ELT2_E1B19K-      --------------------------------------------------
B5SNR1_E1B19K-01        --------------------------------------------------
P10544_E1B19K-01        --------------------------------------------------
W0S1G8_E1B19K-01        --------------------------------------------------
A0A142G3J2_E1B19K-      --------------------------------------------------
P10543_E1B19K-01        --------------------------------------------------
Q71BY5_E1B19K-02        --------------------------------------------------
E1ARN8_E1B19K-01        --------------------------------------------------
A0A2H4PJ75_E1B19K-      --------------------------------------------------
P03246_E1B19K-01        --------------------------------------------------
Q6VGV8_E1B19K-01        --------------------------------------------------
A0A0G2R248_E1B19K-      --------------------------------------------------
Q6WQ37_E1B19K-01        --------------------------------------------------
A0A291P1B2_E1B19K-      --------------------------------------------------
T1UG63_E1B19K-01        --------------------------------------------------
A0A1U9ALK7_E1B19K-      --------------------------------------------------
P03247_E1B19K-01        --------------------------------------------------
J9Z5H0_E1B19K-01        --------------------------------------------------
J7I6T8_E1B19K-01        --------------------------------------------------
J9Z4H6_E1B19K-01        --------------------------------------------------
J9Z4N4_E1B19K-01        --------------------------------------------------
P06501_E1B19K-01        --------------------------------------------------
A0A0M4N3Z1_E1B19K-      --------------------------------------------------
Q8B6X5_E1B19K-01        --------------------------------------------------
H9AAD9_E1B19K-01        --------------------------------------------------
H9AAH3_E1B19K-01        --------------------------------------------------
H9AAA8_E1B19K-01        --------------------------------------------------
M9YVA3_E1B19K-01        --------------------------------------------------
F2WTJ7_E1B19K-01        --------------------------------------------------
F2WTM9_E1B19K-01        --------------------------------------------------
H9AA76_E1B19K-01        --------------------------------------------------
A0A1C8EG46_E1B19K-      --------------------------------------------------
H9AAN8_E1B19K-01        --------------------------------------------------
H9AAS0_E1B19K-01        --------------------------------------------------
H9AAV3_E1B19K-01        --------------------------------------------------
H9AAY5_E1B19K-01        --------------------------------------------------
A0A1L3INW0_E1B19K-      --------------------------------------------------
F6KST6_E1B19K-01        --------------------------------------------------
F2WTG5_E1B19K-01        --------------------------------------------------
Q695T5_E1B19K-01        --------------------------------------------------
H9TER0_E1B19K-01        --------------------------------------------------
A0A0G2UY10_E1B19K-      --------------------------------------------------
X4Y9D2_E1B19K-01        --------------------------------------------------
C5HDR2_E1B19K-01        --------------------------------------------------
M0QVC7_E1B19K-01        --------------------------------------------------
Q4KSL0_E1B19K-01        --------------------------------------------------
A0A1P7YYY5_E1B19K-      --------------------------------------------------
A0A1P8C849_E1B19K-      --------------------------------------------------
B9A5L5_E1B19K-01        --------------------------------------------------
T1UGY3_E1B19K-01        --------------------------------------------------
A0A1P7YWR9_E1B19K-      --------------------------------------------------
A0A1P7YWY2_E1B19K-      --------------------------------------------------
A0A1P7YXN8_E1B19K-      --------------------------------------------------
B9A5A7_E1B19K-01        --------------------------------------------------
T1UG22_E1B19K-01        --------------------------------------------------
H5T740_E1B19K-01        --------------------------------------------------
W8VNG2_E1B19K-01        --------------------------------------------------
F8UFP5_E1B19K-01        --------------------------------------------------
M0QV87_E1B19K-01        --------------------------------------------------
M0QU02_E1B19K-01        --------------------------------------------------
T1UKV6_E1B19K-01        --------------------------------------------------
M0QV47_E1B19K-01        --------------------------------------------------
M0QUW8_E1B19K-01        --------------------------------------------------
E1CIJ0_E1B19K-01        --------------------------------------------------
T1UGU0_E1B19K-01        --------------------------------------------------
M0QVG6_E1B19K-01        --------------------------------------------------
X4YVU5_E1B19K-01        --------------------------------------------------
M0QUS9_E1B19K-01        --------------------------------------------------
G1FBW4_E1B19K-01        --------------------------------------------------
M0QVP5_E1B19K-01        --------------------------------------------------
T1UKQ0_E1B19K-01        --------------------------------------------------
W8CZB0_E1B19K-01        --------------------------------------------------
G1FC01_E1B19K-01        --------------------------------------------------
G3CK71_E1B19K-01        --------------------------------------------------
T1UGT5_E1B19K-01        --------------------------------------------------
T1UK99_E1B19K-01        --------------------------------------------------
M0QTS5_E1B19K-01        --------------------------------------------------
M0QV08_E1B19K-01        --------------------------------------------------
G9JUV5_E1B19K-01        --------------------------------------------------
T1UGX3_E1B19K-01        --------------------------------------------------
T1ULJ8_E1B19K-01        --------------------------------------------------
T1UHG3_E1B19K-01        --------------------------------------------------
A0A1J0MS84_E1B19K-      --------------------------------------------------
A0A097I4T0_E1B19K-      --------------------------------------------------
E9P585_E1B19K-01        --------------------------------------------------
A0A1Y1BXT7_E1B19K-      --------------------------------------------------
E5RWD9_E1B19K-01        --------------------------------------------------
M0QU76_E1B19K-01        --------------------------------------------------
T1UHL7_E1B19K-01        --------------------------------------------------
A0A075TSZ1_E1B19K-      --------------------------------------------------
T1UHH6_E1B19K-01        --------------------------------------------------
T1UKP8_E1B19K-01        --------------------------------------------------
B9A5T7_E1B19K-01        --------------------------------------------------
D3GBW3_E1B19K-01        --------------------------------------------------
M0QUF3_E1B19K-01        --------------------------------------------------
E5RWL1_E1B19K-01        --------------------------------------------------
B6C6W8_E1B19K-01        --------------------------------------------------
M0QU41_E1B19K-01        --------------------------------------------------
F1DT57_E1B19K-01        --------------------------------------------------
B2VQE3_E1B19K-01        --------------------------------------------------
B9A681_E1B19K-01        --------------------------------------------------
A0A1Y1BYF1_E1B19K-      --------------------------------------------------
B6DU90_E1B19K-01        --------------------------------------------------
T1UHZ2_E1B19K-01        --------------------------------------------------
B9A5Q1_E1B19K-01        --------------------------------------------------
M0QUB4_E1B19K-01        --------------------------------------------------
M0QUJ3_E1B19K-01        --------------------------------------------------
M0QUN2_E1B19K-01        --------------------------------------------------
C4P207_E1B19K-01        --------------------------------------------------
E1CIM6_E1B19K-01        --------------------------------------------------
D4N3H6_E1B19K-01        --------------------------------------------------
M0QVK6_E1B19K-01        --------------------------------------------------
M0QVT4_E1B19K-01        --------------------------------------------------
E1AI10_E1B19K-01        --------------------------------------------------
H0PPE7_E1B19K-01        --------------------------------------------------
Q9YL99_E1B19K-01        --------------------------------------------------
K7ZLN6_E1B19K-01        --------------------------------------------------
A0A384ZUF2_E1B19K-      --------------------------------------------------
A0A384ZUM9_E1B19K-      --------------------------------------------------
E1CIR1_E1B19K-01        --------------------------------------------------
T1UHQ8_E1B19K-01        --------------------------------------------------
T1ULP4_E1B19K-01        --------------------------------------------------
A0A291B0H2_E1B19K-      --------------------------------------------------
Q7T951_E1B19K-01        --------------------------------------------------
T1UE63_E1B19K-01        --------------------------------------------------
Q7T8D8_E1B19K-01        --------------------------------------------------
Q8B8U7_E1B19K-01        --------------------------------------------------
Q5UW22_E1B19K-01        --------------------------------------------------
W6EIX6_E1B19K-01        --------------------------------------------------
Q3ZL02_E1B19K-01        --------------------------------------------------
A0A1L7NRH1_E1B19K-      --------------------------------------------------
T1UFS4_E1B19K-01        --------------------------------------------------
Q32UI6_E1B19K-01        --------------------------------------------------
C7SRS7_E1B19K-01        --------------------------------------------------
J7H4R9_E1B19K-01        --------------------------------------------------
D2DM83_E1B19K-01        --------------------------------------------------
J7I6W7_E1B19K-01        --------------------------------------------------
T1UJX4_E1B19K-01        --------------------------------------------------
T2CI10_E1B19K-01        --------------------------------------------------
A0A0K0PX99_E1B19K-      --------------------------------------------------
A0A0K0PX35_E1B19K-      --------------------------------------------------
A0A220VZ73_E1B19K-      --------------------------------------------------
R4HLE1_E1B19K-01        --------------------------------------------------
R4HMC6_E1B19K-01        --------------------------------------------------
I1V161_E1B19K-01        --------------------------------------------------
P03248_E1B19K-02        --------------------------------------------------
Q6RK98_E1B19K-01        --------------------------------------------------
J7I6Q4_E1B19K-01        --------------------------------------------------
J7I6S4_E1B19K-01        --------------------------------------------------
R4HLJ6_E1B19K-01        --------------------------------------------------
R4HLA0_E1B19K-01        --------------------------------------------------
Q2KSL3_E1B19K-01        --------------------------------------------------
Q2Y0J3_E1B19K-01        --------------------------------------------------
Q5EY83_E1B19K-01        --------------------------------------------------
I6LEP5_E1B19K-01        --------------------------------------------------
I6LES1_E1B19K-01        --------------------------------------------------
T1UF50_E1B19K-01        --------------------------------------------------
J7ID56_E1B19K-01        --------------------------------------------------
A0A0B4SJH1_E1B19K-      --------------------------------------------------
A0A075IQ70_E1B19K-      --------------------------------------------------
Q2KS85_E1B19K-01        --------------------------------------------------
Q3ZKW2_E1B19K-01        --------------------------------------------------
K7NG43_E1B19K-01        --------------------------------------------------
Q2KRU2_E1B19K-01        --------------------------------------------------
T1UIP3_E1B19K-01        --------------------------------------------------
Q6QPF3_E1B19K-01        --------------------------------------------------
Q6QPB7_E1B19K-01        --------------------------------------------------
Q6QPI9_E1B19K-01        --------------------------------------------------
P10406_E1B19K-01        --------------------------------------------------
Q5GFC7_E1B19K-01        --------------------------------------------------
A0A2R3WN62_E1B19K-      --------------------------------------------------
Q2KSM8_E1B19K-02        --------------------------------------------------
Q2KSG6_E1B19K-02        --------------------------------------------------
A0A2L1F392_E1B19K-      --------------------------------------------------
Q5GFC8_E1B19K-01        --------------------------------------------------
Q6H1D7_E1B19K-01        --------------------------------------------------
Q2KSG6_E1B19K-01        --------------------------------------------------
Q2KSM8_E1B19K-01        --------------------------------------------------
A0A2R3WN16_E1B19K-      --------------------------------------------------
A0A2L1F3A2_E1B19K-      --------------------------------------------------
G9G841_E1B19K-01        --------------------------------------------------
Q8UY91_E1B19K-01        --------------------------------------------------
                                                                          

Q71BY5_E1B19K-01        -------------------------------------------MRHII--
A0A384ZUF2_E1B19K-      TNIHVGGRNEAGHGREPEERPGPSVGRGAGLNQVSSLYPELSKVLTSMAR
A0A384ZUM9_E1B19K-      TNIHVGGRNEAGHGREPEERPGPSVGRGAGLNQVASLYPELSKVLTSMAR
A0A0M4NHE0_E1B19K-      CELWLFIQRVLPGRYKGSGFQARGIYPLAAFMDLRAELQTFESTRRLV--
H9AAK5_E1B19K-01        CELWLFIQRGLPGRYKGSGFQARGIYPLAAFMDLRAELQTFESTRRLV--
G0ZAH2_E1B19K-01        -------------------------------MDLLKFLEDFENCRQVL--
A0A1W5PVU4_E1B19K-      --------------------MMKRPVAAEVQMELDRLLENYNSLRRVL--
A0A0M3TH18_E1B19K-      ---------------------MKRPVAAEVQMELDRLLENYNSLRRVL--
A0A097IW62_E1B19K-      -------------------------------MDLDRVLENYNSLRKVV--
A0A0A1EUE4_E1B19K-      ----------------------MGSESTSALMDLLGNLREFDVVRRLL--
A0A2H5AI40_E1B19K-      ----------------------MGSESTAALMDLLGNLREFDVVRRLL--
A0A2H5AID8_E1B19K-      ----------------------MGSESTAALMDLLGNLREFDVVRRLL--
A0A2H5AII9_E1B19K-      ----------------------MGSESTAALMDLLGNLREFDVVRRLL--
A0A2H5AIL0_E1B19K-      ----------------------MGSESTAALMDLLGNLREFDVVRRLL--
A0A2H5AIN5_E1B19K-      ----------------------MGSESTAALMDLLGNLREFDVVRRLL--
A0A2H5AIS9_E1B19K-      ----------------------MGSESTAALMDLLGNLREFDVVRRLL--
A0A2H5AIT6_E1B19K-      ----------------------MGSESTAALMDLLGNLREFDVVRRLL--
A0A2H5AIU0_E1B19K-      ----------------------MGSESTAALMDLLGNLREFDVVRRLL--
A0A2H5AIC5_E1B19K-      ----------------------MGSESTAALMDLLGNLREFDVVRRLL--
D3JIR7_E1B19K-01        -------------------------------MELEAVLQSYQGVRQLL--
A0A076V686_E1B19K-      -------------------------------MELEAVLQSYQSIRQLL--
P04492_E1B19K-01        -------------------------------MELETVLQSFQSVRQLL--
G1DE13_E1B19K-01        -------------------------------MELEAVLQSFQSVRQLL--
D0Z5R9_E1B19K-01        -------------------------------MELEAVLQSFQSVRQLL--
T1UEX7_E1B19K-01        -------------------------------MELEAVLQSFQSVRQLL--
A0A2H5AI99_E1B19K-      -------------------------------MDLLKELRDFDVVRQLL--
A0A0M3TH31_E1B19K-      -------------------------------MDLLRLLSDYEVLRKLL--
M9YXY5_E1B19K-01        -------------------------------MDLLRLLSDYEVLRKLL--
M9YVF6_E1B19K-01        -------------------------------MDLLRLLSDYEVLRKLL--
A0MK43_E1B19K-01        -------------------------------MDLLGNLREFDVVRRLL--
A0A2H5AI21_E1B19K-      -------------------------------MDLLGDLREFGVVRRLL--
A0A0M5L3Y4_E1B19K-      -------------------------------MDLLGDLREFGVVRRLL--
Q5C8R2_E1B19K-01        -------------------------------MDLLGDLREFGVVRRLL--
A0A0A1EUB2_E1B19K-      -------------------------------MDLLGDLREFGVVRRLL--
A0A0A1EUC8_E1B19K-      -------------------------------MDLLGDLREFGVVRRLL--
A0A2H5AI04_E1B19K-      -------------------------------MDLLGDLREFGVVRRLL--
A0A2H5AI72_E1B19K-      -------------------------------MDLLGDLREFGVVRRLL--
A0A2H5AIL3_E1B19K-      -------------------------------MDLLGDLREFGVVRRLL--
A0A2H4CJZ0_E1B19K-      -------------------------------MEFWSELQNYQSLRHLL--
H8PFZ1_E1B19K-01        -------------------------------MEYWSELQNYQSLRRLL--
F4ZCJ8_E1B19K-01        -------------------------------MEFWSELQSYQSLRRLL--
A0A1S6ELT2_E1B19K-      -------------------------------MEFWSELQSYQSLRRLL--
B5SNR1_E1B19K-01        -------------------------------MEFWSELQSYQSLRRLL--
P10544_E1B19K-01        -------------------------------MEFWSELQSYQSLRRLL--
W0S1G8_E1B19K-01        -------------------------------MEFWSELQSYQSLRRLL--
A0A142G3J2_E1B19K-      -------------------------------MELWSELQSYQNLRRLL--
P10543_E1B19K-01        -------------------------------MELWSELQSYQNLRRLL--
Q71BY5_E1B19K-02        -------------------------------MEAWECLEDFSAVRNLL--
E1ARN8_E1B19K-01        -------------------------------MEAWECLEDFSAVRNLL--
A0A2H4PJ75_E1B19K-      -------------------------------MEAWECLEDFSAVRNLL--
P03246_E1B19K-01        -------------------------------MEAWECLEDFSAVRNLL--
Q6VGV8_E1B19K-01        -------------------------------MEAWECLEDFSAVRNLL--
A0A0G2R248_E1B19K-      -------------------------------MEAWECLEDFSAVRNLL--
Q6WQ37_E1B19K-01        -------------------------------MEAWECLEDFSAVRNLL--
A0A291P1B2_E1B19K-      -------------------------------METWECLEDFSAVRNLL--
T1UG63_E1B19K-01        -------------------------------MEAWECLEDFSAVRNLL--
A0A1U9ALK7_E1B19K-      -------------------------------MEAWECLEDFSAVRNLL--
P03247_E1B19K-01        -------------------------------MEAWECLEDFSAVRNLL--
J9Z5H0_E1B19K-01        -------------------------------MEAWECLEDFSAVRNLL--
J7I6T8_E1B19K-01        -------------------------------MEAWECLEDFSAVRNLL--
J9Z4H6_E1B19K-01        -------------------------------MEAWECLEDFSAVRNLL--
J9Z4N4_E1B19K-01        -------------------------------MEAWECLEDFSAVRNLL--
P06501_E1B19K-01        -------------------------------MDLRTALQTFESTRRLL--
A0A0M4N3Z1_E1B19K-      -------------------------------MDLRTALQTFESTRRLL--
Q8B6X5_E1B19K-01        -------------------------------MDLRTALQTFESTRRLL--
H9AAD9_E1B19K-01        -------------------------------MDLRAELQTFESTRRLV--
H9AAH3_E1B19K-01        -------------------------------MDLRAELQTFESTRRLV--
H9AAA8_E1B19K-01        -------------------------------MDLRVELQTFESTRCLL--
M9YVA3_E1B19K-01        -------------------------------MDLRVELQTFESTRCLL--
F2WTJ7_E1B19K-01        -MINDVNFVCLFKGDYLGGIKGAAVGLGHFTMDLRVELQTFESTRCLL--
F2WTM9_E1B19K-01        -MINDVNFVCLFKGDYLGGIKGAAVGLGHFTMNLRVELQTFESTRCLL--
H9AA76_E1B19K-01        -MINDVNFVCLFKGDYLGGIKGVVVRLGHFTMDLRVELQTFESTRCLL--
A0A1C8EG46_E1B19K-      -MINDVNFVCLFKGDYLGGIKGAVVRLGHFTMDLRVELQTFESTRCLL--
H9AAN8_E1B19K-01        -MINDVNFVCLFKGDYLGGIKGAVVRLGHFTMDLRVELQTFESTRCLL--
H9AAS0_E1B19K-01        -MINDVNFVCLFKGDYLGGIKGAVVRLGHFTMDLRVELQTFESTRCLL--
H9AAV3_E1B19K-01        -MINDVNFVCLFKGDYLGGIKGAVVRLGHFTMDLRVELQTFESTRCLL--
H9AAY5_E1B19K-01        -MINDVNFVCLFKGDYLGGIKGAVVRLGHFTMDLRVELQTFESTRCLL--
A0A1L3INW0_E1B19K-      -------------------------------MDLYKSLEDRSTLRQLL--
F6KST6_E1B19K-01        -------------------------------MDLYESLENLGSLRRLL--
F2WTG5_E1B19K-01        -------------------------------MDLYESLENLSSLRRLL--
Q695T5_E1B19K-01        -------------------------------MDLYESLENLSSLRRLL--
H9TER0_E1B19K-01        -------------------------------MDLYESLENLSSLRRLL--
A0A0G2UY10_E1B19K-      -----MTHGRGLVLYKWQHLGTWAQTFREFLMDVWTILADFSKTRRLV--
X4Y9D2_E1B19K-01        -----MTHGRGLVLYKWQHLGTRAQTFREFLMDVWTILADFSKTRRLV--
C5HDR2_E1B19K-01        -----MTHGRGLVLYKWQHLGTWAQTFREFLMDVWTILADFSKTRRLV--
M0QVC7_E1B19K-01        -----MTHGRGLVLYKWQHLGTGAQTFRKFLMDVWTILADFSKTRRLV--
Q4KSL0_E1B19K-01        -----MTHGRGLVLYKWQHLGTGAQTFREFLMDVWTILADFSKTRRLV--
A0A1P7YYY5_E1B19K-      -------------------------------MDVWSILGEFNKTRRLV--
A0A1P8C849_E1B19K-      -------------------------------MDVWSILGEFNKTRRLV--
B9A5L5_E1B19K-01        -------------------------------MDVWSILGEFNKTRRLV--
T1UGY3_E1B19K-01        -------------------------------MDVWSILGEFNKTRRLV--
A0A1P7YWR9_E1B19K-      -------------------------------MDVWSILGEFNKTRRLV--
A0A1P7YWY2_E1B19K-      -------------------------------MDVWSILGEFNKTRRLV--
A0A1P7YXN8_E1B19K-      -------------------------------MDVWSILGEFNKTRRLV--
B9A5A7_E1B19K-01        -------------------------------MDVWSILGEFNKTRRLV--
T1UG22_E1B19K-01        -------------------------------MDVWSILGEFNKTRRLV--
H5T740_E1B19K-01        -------------------------------MEVWTILADFNKTRRLV--
W8VNG2_E1B19K-01        -------------------------------MEVWTILGDFNKTRRLV--
F8UFP5_E1B19K-01        -------------------------------MEVWTILADFNKTRRLV--
M0QV87_E1B19K-01        -------------------------------MDVWTILGDFVKTRRLV--
M0QU02_E1B19K-01        -------------------------------MDVWTILADFNKTRRLV--
T1UKV6_E1B19K-01        -------------------------------MDVWTILGDFNKTRRLV--
M0QV47_E1B19K-01        -------------------------------MEVWTILADFNKTRRLV--
M0QUW8_E1B19K-01        -------------------------------MEVWTILADFNKTRRLV--
E1CIJ0_E1B19K-01        -------------------------------MEVWTILADFNKTRRLV--
T1UGU0_E1B19K-01        -------------------------------MEVWTILADFNKTRRLV--
M0QVG6_E1B19K-01        -------------------------------MEVWTILADFSKTRRLV--
X4YVU5_E1B19K-01        -------------------------------MEVWTILADFSKTRRLV--
M0QUS9_E1B19K-01        -------------------------------MEVWTILADFNKTRRLV--
G1FBW4_E1B19K-01        -------------------------------MEVWTILADFNKTRRLV--
M0QVP5_E1B19K-01        -------------------------------MDVWTILADFNKTRRLV--
T1UKQ0_E1B19K-01        -------------------------------MDVWTILADFNKTRRLV--
W8CZB0_E1B19K-01        -------------------------------MEVWTILGDFNKTRRLV--
G1FC01_E1B19K-01        -------------------------------MEVWTILGDFNKTRRLV--
G3CK71_E1B19K-01        -------------------------------MEVWTILGDFNKTRRLV--
T1UGT5_E1B19K-01        -------------------------------MEVWTILADFNKTRRLV--
T1UK99_E1B19K-01        -------------------------------MEVWTILGDFNKTRRLV--
M0QTS5_E1B19K-01        -------------------------------MEVWTILADFSKTRRLV--
M0QV08_E1B19K-01        -------------------------------MEVWTILADFSKTRRLV--
G9JUV5_E1B19K-01        -------------------------------MEVWTILADFSKTRRLV--
T1UGX3_E1B19K-01        -------------------------------MDVWTILADFSQTRRLV--
T1ULJ8_E1B19K-01        -------------------------------MDVWTILADFSKTRRLV--
T1UHG3_E1B19K-01        -------------------------------MDVWTILADFSKTRRLV--
A0A1J0MS84_E1B19K-      -------------------------------MDVWTILADFSKTRRLV--
A0A097I4T0_E1B19K-      -------------------------------MDVWTILADFSKTRRLV--
E9P585_E1B19K-01        -------------------------------MDVWTILADFSKTRRLV--
A0A1Y1BXT7_E1B19K-      -------------------------------MDVWTILADFSKTRRLV--
E5RWD9_E1B19K-01        -------------------------------MDVWTILADFSKTRRLV--
M0QU76_E1B19K-01        -------------------------------MDVWTILADFSKTRRLV--
T1UHL7_E1B19K-01        -------------------------------MDVWTILADFSKTRRLV--
A0A075TSZ1_E1B19K-      -------------------------------MDVWTILADFSKTRRLV--
T1UHH6_E1B19K-01        -------------------------------MDVWTILADFSKTRRLV--
T1UKP8_E1B19K-01        -------------------------------MDVWTILADFSKTRRLV--
B9A5T7_E1B19K-01        -------------------------------MDVWTILADFSKTRRLV--
D3GBW3_E1B19K-01        -------------------------------MDVWTILADFSKTRRLV--
M0QUF3_E1B19K-01        -------------------------------MDVWTILADFSKTRRLV--
E5RWL1_E1B19K-01        -------------------------------MDVWTILADFSKTRRLV--
B6C6W8_E1B19K-01        -------------------------------MDVWTILADFSKTRRLV--
M0QU41_E1B19K-01        -------------------------------MDVWTILADFSKTRRLV--
F1DT57_E1B19K-01        -------------------------------MDVWTILADFSKTRRLV--
B2VQE3_E1B19K-01        -------------------------------MDVWTILADFSKTRRLV--
B9A681_E1B19K-01        -------------------------------MDVWTILADFSKTRRLV--
A0A1Y1BYF1_E1B19K-      -------------------------------MDVWTILADFSKTRRLV--
B6DU90_E1B19K-01        -------------------------------MDVWTILADFSKTRRLV--
T1UHZ2_E1B19K-01        -------------------------------MDVWTILADFSKTRRLV--
B9A5Q1_E1B19K-01        -------------------------------MDVWTILADFSKTRRLV--
M0QUB4_E1B19K-01        -------------------------------MDVWTILADFSKTRRLV--
M0QUJ3_E1B19K-01        -------------------------------MDVWTILADFSKTRRLV--
M0QUN2_E1B19K-01        -------------------------------MDVWTILADFSKTRRLV--
C4P207_E1B19K-01        -------------------------------MDVWTILADFSKTRRLV--
E1CIM6_E1B19K-01        -------------------------------MDVWTILADFSKTRRLV--
D4N3H6_E1B19K-01        -------------------------------MDVWTILADFSKTRRLV--
M0QVK6_E1B19K-01        -------------------------------MDVWTILADFSKTRRLV--
M0QVT4_E1B19K-01        -------------------------------MDVWTILADFSKTRRLV--
E1AI10_E1B19K-01        -------------------------------MDVWTILADFSKTRRLV--
H0PPE7_E1B19K-01        -------------------------------MDVWTILADFSKTRRLV--
Q9YL99_E1B19K-01        -------------------------------MDVWTILADFSKTRRLV--
K7ZLN6_E1B19K-01        -------------------------------MDVWTILADFSKTRRLV--
A0A384ZUF2_E1B19K-      -------------------------------MDVWTILADFSKTRRLV--
A0A384ZUM9_E1B19K-      -------------------------------MDVWTILADFSKTRRLV--
E1CIR1_E1B19K-01        -------------------------------MDVWTILADFSKTRRLV--
T1UHQ8_E1B19K-01        -------------------------------MDVWTILADFSKTRRLV--
T1ULP4_E1B19K-01        -------------------------------MDVWTILADFSKTRRLV--
A0A291B0H2_E1B19K-      -------------------------------MDVWTILGDFSKTRRLV--
Q7T951_E1B19K-01        -------------------------------MEVWAILEDLRKTRQLL--
T1UE63_E1B19K-01        -------------------------------MEVWAILEDLRKTRQLL--
Q7T8D8_E1B19K-01        -------------------------------MEVWAILEDLRKTRQLL--
Q8B8U7_E1B19K-01        -------------------------------MEVWAILEDLRKTRQLL--
Q5UW22_E1B19K-01        -------------------------------MEVWAILEDLRKTRQLL--
W6EIX6_E1B19K-01        -------------------------------MEVWAILEDLRKTRQLL--
Q3ZL02_E1B19K-01        -------------------------------MEVWAILEDLRKTRQLL--
A0A1L7NRH1_E1B19K-      -------------------------------MEVWAILEDLRKTRQLL--
T1UFS4_E1B19K-01        -------------------------------MEVWAILEDLRKTRQLL--
Q32UI6_E1B19K-01        -------------------------------MEVWAILEDLRKTRQLL--
C7SRS7_E1B19K-01        -------------------------------MEVWAILEDLRKTRQLL--
J7H4R9_E1B19K-01        -------------------------------MEVWAILEDLRKTRQLL--
D2DM83_E1B19K-01        -------------------------------MEVWAILEDLRKTRQLL--
J7I6W7_E1B19K-01        -------------------------------MEVWAILEDLRKTRQLL--
T1UJX4_E1B19K-01        -------------------------------MEVWAILEDLRKTRQLL--
T2CI10_E1B19K-01        -------------------------------MEVWAILEDLRQTRQLL--
A0A0K0PX99_E1B19K-      -------------------------------MEVWAILEDLRQTRLLL--
A0A0K0PX35_E1B19K-      -------------------------------MEVWAILEDLRQTRLLL--
A0A220VZ73_E1B19K-      -------------------------------MEVWAILEDLRQTRLLL--
R4HLE1_E1B19K-01        -------------------------------MEVWAILEDLRQTRLLL--
R4HMC6_E1B19K-01        -------------------------------MEVWAILEDLRQTRLLL--
I1V161_E1B19K-01        -------------------------------MEVWAILEDLRQTRLLL--
P03248_E1B19K-02        -------------------------------MEVWAILEDLRQTRLLL--
Q6RK98_E1B19K-01        -------------------------------MEVWAILEDLRQTRLLL--
J7I6Q4_E1B19K-01        -------------------------------MEVWAILEDLRQTRLLL--
J7I6S4_E1B19K-01        -------------------------------MEVWAILEDLRQTRLLL--
R4HLJ6_E1B19K-01        -------------------------------MEVWAILEDLRQTRLLL--
R4HLA0_E1B19K-01        -------------------------------MEVWAILEDLRQTRLLL--
Q2KSL3_E1B19K-01        -------------------------------MEVWAILEDLRQTRLLL--
Q2Y0J3_E1B19K-01        -------------------------------MEVWAILEDLRQTKLLL--
Q5EY83_E1B19K-01        -------------------------------MEVWAILEDLRQTRLLL--
I6LEP5_E1B19K-01        -------------------------------MEVWAILEDLRQTRLLL--
I6LES1_E1B19K-01        -------------------------------MEVWAILEDLRQTRLLL--
T1UF50_E1B19K-01        -------------------------------MKVWAILEDLRQTRLLL--
J7ID56_E1B19K-01        -------------------------------MEVWAILEDLKQTRLLL--
A0A0B4SJH1_E1B19K-      -------------------------------MEVWAILEDLKQTRLLL--
A0A075IQ70_E1B19K-      -------------------------------MEVWAILEDLKQTRLLL--
Q2KS85_E1B19K-01        -------------------------------MEVWAILEDLRQTRLLL--
Q3ZKW2_E1B19K-01        -------------------------------MEVWAILEDLRQTRLLL--
K7NG43_E1B19K-01        -------------------------------MEVWAILEDLRQTRLLL--
Q2KRU2_E1B19K-01        -------------------------------MEVWAILEDLRQTRLLL--
T1UIP3_E1B19K-01        -------------------------------MEVWAILEDLRQTRLLL--
Q6QPF3_E1B19K-01        -------------------------------MEIWTVLEDFHQTRQLL--
Q6QPB7_E1B19K-01        -------------------------------MEIWTVLEDFHQTRQLL--
Q6QPI9_E1B19K-01        -------------------------------MEIWTVLEDFHQTRQLL--
P10406_E1B19K-01        -------------------------------MEIWTVLEDFHKTRQLL--
Q5GFC7_E1B19K-01        -------------------------------MEIWTVLEDFHKTRQLL--
A0A2R3WN62_E1B19K-      -------------------------------MEIWTVLEDFHKTRQLL--
Q2KSM8_E1B19K-02        -------------------------------MEIWTVLEDFYKTRQLL--
Q2KSG6_E1B19K-02        -------------------------------MEIWTVLEDFYKTRQLL--
A0A2L1F392_E1B19K-      -------------------------------MEIWTVLEDFYKTRQLL--
Q5GFC8_E1B19K-01        -------------------------------MEIWTVLEDFHKTRQLL--
Q6H1D7_E1B19K-01        -------------------------------MEIWTVLEDFHKTRQLL--
Q2KSG6_E1B19K-01        -------------------------------MEIWTVLEDFYKTRQLL--
Q2KSM8_E1B19K-01        -------------------------------MEIWTVLEDFYKTRQLL--
A0A2R3WN16_E1B19K-      -------------------------------MEIWTVLEDFYKTRQLL--
A0A2L1F3A2_E1B19K-      -------------------------------MEIWTVLEDFYKTRQLL--
G9G841_E1B19K-01        -------------------------------MEIWTILEDLHKTRQLL--
Q8UY91_E1B19K-01        -------------------------------MEIWTVLEDFHKTRQLL--
                                                                       :  

Q71BY5_E1B19K-01        -----------------CHGGVITE------------EMAASLLD-----
A0A384ZUF2_E1B19K-      GVKRERSDGGNTGMMTELTASLMNRKRPERLTWYELQQECRDELGLMQDK
A0A384ZUM9_E1B19K-      GVKRERSDGGNTGMMTELTASLMNRKRPERITWHELQQECRDEIGLMQDK
A0A0M4NHE0_E1B19K-      ----ELCSNRSSWFGRFLFGSTLCR------VVRQVKEEYQSEFE-----
H9AAK5_E1B19K-01        ----ELCSNRSSWFGRFLFGSTLCR------VVRQVKEEYQSEFE-----
G0ZAH2_E1B19K-01        ----QQASKRTGGWSRWLLGNQLVR------TVAQVKTDYSEHFE-----
A0A1W5PVU4_E1B19K-      ----EEASEDTSVWWRRLFGCRVSQ------LVVQAKVEYKEEFE-----
A0A0M3TH18_E1B19K-      ----EEASEDTSVWWRKLFGCRVSQ------LVVQAKVEYKEEFE-----
A0A097IW62_E1B19K-      ----EEASEQTSGWWRKLFGCRLSC------LVVQAKFEYREEFE-----
A0A0A1EUE4_E1B19K-      ----ELASDKTSRLWRFWFGSTLSS------VVYRVKKEQEGQFS-----
A0A2H5AI40_E1B19K-      ----ELASDKTSRLWRFWFGSTLSS------VVYRVKREQEAQFA-----
A0A2H5AID8_E1B19K-      ----ELASDKTSRLWRFWFGSTLSS------VVYRVKREQEAQFA-----
A0A2H5AII9_E1B19K-      ----ELASDKTSRLWRFWFGSTLSS------VVYRVKREQEAQFA-----
A0A2H5AIL0_E1B19K-      ----ELASDKTSRLWRFWFGSTLSS------VVYRVKREQEAQFA-----
A0A2H5AIN5_E1B19K-      ----ELASDKTSRLWRFWFGSTLSS------VVYRVKREQEAQFA-----
A0A2H5AIS9_E1B19K-      ----ELASDKTSRLWRFWFGSTLSS------VVYRVKREQEAQFA-----
A0A2H5AIT6_E1B19K-      ----ELASDKTSRLWRFWFGSTLSS------VVYRVKREQEAQFA-----
A0A2H5AIU0_E1B19K-      ----ELASDKTSRLWRFWFGSTLSS------VVYRVKREQEAQFA-----
A0A2H5AIC5_E1B19K-      ----ELASDKTSRLWRFWFGSTLSS------VVYRVKREQEAQFA-----
D3JIR7_E1B19K-01        ----QYTSKNTSGFWRYLFGSTLCK------VVHRVKEDYRKEFE-----
A0A076V686_E1B19K-      ----QHTSRNTSGFWRYLFGSTLSK------VVHRVKEDYRNEFE-----
P04492_E1B19K-01        ----QYTSKNTSGFWRYLFGSTLSK------VVNRVKEDYREEFE-----
G1DE13_E1B19K-01        ----QYTSKNTSGFWRYLFGSTFSK------VVHRVKEDYREEFE-----
D0Z5R9_E1B19K-01        ----QYTSKNTSGFWRYLFGSTLSK------VVHRVKEDYREEFE-----
T1UEX7_E1B19K-01        ----QYTSKNTSGFWRYLFGSTLSK------VVHRVKEDYREEFE-----
A0A2H5AI99_E1B19K-      ----ESASDKTSKFWRFCFGSTLSN------VVYRVKKEQAEQFS-----
A0A0M3TH31_E1B19K-      ----ETACEKTSSCWRFFFGSTLSN------VVHRVKREHSEEFS-----
M9YXY5_E1B19K-01        ----ETACEKTSSCWRFFFGSTLSN------VVHRVKREHSEEFS-----
M9YVF6_E1B19K-01        ----ETACEKNRSCWRFFFGSTLSN------VVHRVKREHSEEFS-----
A0MK43_E1B19K-01        ----ELASDKTSRLWRFWFGSTLSS------VVYRVKREQEAQFA-----
A0A2H5AI21_E1B19K-      ----ELASDRTSKFWRFCFGSTLSN------VLYRVKKEQETQFA-----
A0A0M5L3Y4_E1B19K-      ----ELASDRTSKFWRFCFGSTLSN------VLYRVKKEQETQFA-----
Q5C8R2_E1B19K-01        ----ELASDRTSKFWRFCFGSTLSN------VLYRVKKEQETQFA-----
A0A0A1EUB2_E1B19K-      ----ELASDRTSKFWRFCFGSTLSN------VLYRVKKEQETQFA-----
A0A0A1EUC8_E1B19K-      ----ELASDRTSKFWRFCFGSTLSN------VLYRVKKEQETQFA-----
A0A2H5AI04_E1B19K-      ----ELASDRTSKFWRFCFGSTLSN------VLYRVKKEQETQFA-----
A0A2H5AI72_E1B19K-      ----ELASDRTSKFWRFCFGSTLSN------VLYRVKKEQETQFA-----
A0A2H5AIL3_E1B19K-      ----ELASDRTSKFWRFCFGSTLSN------VLYRVKKEQETQFA-----
A0A2H4CJZ0_E1B19K-      ----ELASARTSTCWRFCFGSTLSN------VVYRVKQEYSSRFS-----
H8PFZ1_E1B19K-01        ----ELASARTSTCWRFCFGSTLSN------VVYRVKQEYSSRFS-----
F4ZCJ8_E1B19K-01        ----ELASARTSSCWRFIFGSTLTN------VIYRAKEDYSSRFA-----
A0A1S6ELT2_E1B19K-      ----ELASARTSSCWRFIFGSTLTN------VIYRAKEDYSSRFA-----
B5SNR1_E1B19K-01        ----ELASARTSSCWRFIFGSTLTN------VIYRAKEDYSSRFA-----
P10544_E1B19K-01        ----ELASARTSSCWRFIFGSTLTN------VIYRAKEDYSSRFA-----
W0S1G8_E1B19K-01        ----ELASARTSSCWRFIFGSTLTN------VIYRAKEDYSSRFA-----
A0A142G3J2_E1B19K-      ----ELASARTSSCWRILFGSTLAN------VIYRAKEEYSSRFA-----
P10543_E1B19K-01        ----ELASARTSSCWRILFGSTLTN------VIYRAKEEYSSRFA-----
Q71BY5_E1B19K-02        ----EQSSNSTSWFWRFLWGSSQAK------LVCRIKEDYKWEFE-----
E1ARN8_E1B19K-01        ----EQSSNSTSWFWRFLWGSSQAK------LVCRIKEDYKWEFE-----
A0A2H4PJ75_E1B19K-      ----EQSSNSTSWFWRFLWGSSQAK------LVCRIKEDYKWEFE-----
P03246_E1B19K-01        ----EQSSNSTSWFWRFLWGSSQAK------LVCRIKEDYKWEFE-----
Q6VGV8_E1B19K-01        ----EQSSNSTSWFWRFLWGSSQAK------LVCRIKEDYKWEFE-----
A0A0G2R248_E1B19K-      ----EQSSNSTSWFWRFLWGSSQAK------LVCRIKEDYKWEFE-----
Q6WQ37_E1B19K-01        ----EQSSNSTSWFWRFLWGSSQAK------LVCRIKEDYKWEFE-----
A0A291P1B2_E1B19K-      ----EQSSNSTSWFWRFLWGSSQAK------LVCRIKEDYKWEFE-----
T1UG63_E1B19K-01        ----EQSSNSTSWFWRFLWGSSQAK------LVCRIKEDYKWEFE-----
A0A1U9ALK7_E1B19K-      ----EQSSNSTSWFWRFLWGSSQAK------LVCRIKEDYKWEFE-----
P03247_E1B19K-01        ----EQSSNSTSWFWRFLWGSSQAK------LVCRIKEDYKWEFE-----
J9Z5H0_E1B19K-01        ----EQSSNSTSWFWRFLWGSSQAK------LVCRIKEDYKWEFE-----
J7I6T8_E1B19K-01        ----EQSSNSTSWFWRFLWGSSQAK------LVCRIKEDYKWEFE-----
J9Z4H6_E1B19K-01        ----EQSSNSTSWFWRFLWGSSQAK------LVCRIKEDYKWEFE-----
J9Z4N4_E1B19K-01        ----EQSSNSTSWFWRFLWGSSQAK------LVCRIKEDYKWEFE-----
P06501_E1B19K-01        ----ELCSNRTSFLWRWLFGTPLSR------LVRQVKLEYEKDFE-----
A0A0M4N3Z1_E1B19K-      ----ELCSNRTSFLWRWLFGTPLSR------LVRQVKLEYEKDFE-----
Q8B6X5_E1B19K-01        ----ELCSNRTSFLWRWLFGTPLSR------LVRQVKLEYEKDFE-----
H9AAD9_E1B19K-01        ----ELCSNRSSWFGRFLFGSTLCR------VVRQVKEEYQSEFE-----
H9AAH3_E1B19K-01        ----ELCSNRSSWFGRFLFGSTLCR------VVRQVKEEYQSEFE-----
H9AAA8_E1B19K-01        ----ELCSNRASWWKRLLFGTSLCR------LVRQVKEEYQSEFE-----
M9YVA3_E1B19K-01        ----ELCSNRDPWWKRLLFGTSLCR------LVRQVKEEYQSEFE-----
F2WTJ7_E1B19K-01        ----ELCSNRASWWKRLLFGTSLCR------LVRQVKEEYESEFE-----
F2WTM9_E1B19K-01        ----ELCSNRASWWKRLLFGTSLCR------LVRQVKEEYESEFE-----
H9AA76_E1B19K-01        ----ELCSNRASWWKRLLFGTSLCR------LVRQVKEEYQSEFE-----
A0A1C8EG46_E1B19K-      ----ELCSNRASWWKRLLFGTSLCR------LVRQVKEEYQSEFE-----
H9AAN8_E1B19K-01        ----ELCSNRASWWKRLLFGTSLCR------LVRQVKEEYQSEFE-----
H9AAS0_E1B19K-01        ----ELCSNRASWWKRLLFGTSLCR------LVRQVKEEYQSEFE-----
H9AAV3_E1B19K-01        ----ELCSNRASWWKRLLFGTSLCR------LVRQVKEEYQSEFE-----
H9AAY5_E1B19K-01        ----ELCSNRASWWKRLLFGTSLCR------LVRQVKEEYQSEFE-----
A0A1L3INW0_E1B19K-      ----EEASNSTSYCWRFLFGSPLGR------FLYRVKKDHQEEFD-----
F6KST6_E1B19K-01        ----EEASDRTSYFWRFLCGSPLSR------FLNRVKREHRAEFD-----
F2WTG5_E1B19K-01        ----EEASDRTSYIWRFLFGSPLSR------FLYRVKREHLTEFD-----
Q695T5_E1B19K-01        ----EEASDRTSYIWRFLFGSPLSR------FLYRVKREHLTEFD-----
H9TER0_E1B19K-01        ----EEASDRTSYIWRFLFGSPLSR------FLHRVKREHLTEFD-----
A0A0G2UY10_E1B19K-      ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYNEEFE-----
X4Y9D2_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYNEEFE-----
C5HDR2_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYNEEFE-----
M0QVC7_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYNEEFE-----
Q4KSL0_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYNEEFE-----
A0A1P7YYY5_E1B19K-      ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYSEEFE-----
A0A1P8C849_E1B19K-      ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYSEEFE-----
B9A5L5_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYSEEFE-----
T1UGY3_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYSEEFE-----
A0A1P7YWR9_E1B19K-      ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYSEEFE-----
A0A1P7YWY2_E1B19K-      ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYSEEFE-----
A0A1P7YXN8_E1B19K-      ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYSEEFE-----
B9A5A7_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYSEEFE-----
T1UG22_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYSEEFE-----
H5T740_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLAR------LVYTVKKDYQDEFE-----
W8VNG2_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYSEEFE-----
F8UFP5_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYSEEFE-----
M0QV87_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYSEEFE-----
M0QU02_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYQEEFE-----
T1UKV6_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYSEEFE-----
M0QV47_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLAR------LVYTVKKDYQEEFE-----
M0QUW8_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLAR------LVYTVKKDYQEEFE-----
E1CIJ0_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLAR------LVYTVKKDYQEEFE-----
T1UGU0_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLAR------LVYTVKKDYQEEFE-----
M0QVG6_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYNEEFE-----
X4YVU5_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYNEEFE-----
M0QUS9_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYKEEFE-----
G1FBW4_E1B19K-01        ----EDSSDGCSGFWRHWFGSPLSR------LVYTVKKDYQEEFE-----
M0QVP5_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYQEEFE-----
T1UKQ0_E1B19K-01        ----EDSSDGCSGFWRHWFGSPLSR------LVYTVKKDYQEEFE-----
W8CZB0_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYNEEFE-----
G1FC01_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYNEEFE-----
G3CK71_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYNEEFE-----
T1UGT5_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYNEEFE-----
T1UK99_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYQEEFE-----
M0QTS5_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYNEEFE-----
M0QV08_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYNEEFE-----
G9JUV5_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYNEEFE-----
T1UGX3_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYKEEFE-----
T1ULJ8_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYKEEFE-----
T1UHG3_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYKEEFE-----
A0A1J0MS84_E1B19K-      ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYNEEFE-----
A0A097I4T0_E1B19K-      ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYNEEFE-----
E9P585_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYKEEFE-----
A0A1Y1BXT7_E1B19K-      ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYKEEFE-----
E5RWD9_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYNEEFE-----
M0QU76_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYNEEIE-----
T1UHL7_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYNEEFE-----
A0A075TSZ1_E1B19K-      ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYKEEFE-----
T1UHH6_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYKEEFE-----
T1UKP8_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYNEEFE-----
B9A5T7_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYNEEFE-----
D3GBW3_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYNEEFE-----
M0QUF3_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYNEEFE-----
E5RWL1_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYNEEFE-----
B6C6W8_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYNEEFE-----
M0QU41_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYNEEFE-----
F1DT57_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYNEEFE-----
B2VQE3_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYNEEFE-----
B9A681_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYNEEFE-----
A0A1Y1BYF1_E1B19K-      ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYNEEFE-----
B6DU90_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYNEEFE-----
T1UHZ2_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYNEEFE-----
B9A5Q1_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYKEEFE-----
M0QUB4_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYKEEFE-----
M0QUJ3_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYKEEFE-----
M0QUN2_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYKEEFE-----
C4P207_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYKEEFE-----
E1CIM6_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYKEEFE-----
D4N3H6_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYKEEFE-----
M0QVK6_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYKEEFE-----
M0QVT4_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYKEEFE-----
E1AI10_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYKEEFE-----
H0PPE7_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYKEEFE-----
Q9YL99_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYKEEFE-----
K7ZLN6_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYKEEFE-----
A0A384ZUF2_E1B19K-      ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYKEEFE-----
A0A384ZUM9_E1B19K-      ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYKEEFE-----
E1CIR1_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYKEEFE-----
T1UHQ8_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYNEEFE-----
T1ULP4_E1B19K-01        ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYKEEFE-----
A0A291B0H2_E1B19K-      ----EDSSDGCSGFWRHWFGTPLSR------LVYTVKKDYSEEFE-----
Q7T951_E1B19K-01        ----ESASDGVSGFWRFWFASELAR------VVFRIKQDYKQEFE-----
T1UE63_E1B19K-01        ----ESASDGVSGFWRFWFASELAR------VVFRIKQDYKQEFE-----
Q7T8D8_E1B19K-01        ----ENASDGVSGFWRFWFASELAR------VVFRIKQDYKQEFE-----
Q8B8U7_E1B19K-01        ----ENASDGVSGFWRFWFASELAR------VVFRIKQDYNQEFE-----
Q5UW22_E1B19K-01        ----ENASDGVSGFWRFWFASELAR------VVFRIKQDYKQEFE-----
W6EIX6_E1B19K-01        ----EDASDGVSGFWRFWFASELAR------VVFRIKQDYKEEFE-----
Q3ZL02_E1B19K-01        ----EDASDGVSGFWRFWFASELAR------VVFRIKQDYKEEFE-----
A0A1L7NRH1_E1B19K-      ----EDASDGVSGFWRFWFASELAR------VVFRIKQDYKEEFE-----
T1UFS4_E1B19K-01        ----EDASDGVSGFWRFWFASELAR------VVFRIKQDYKEEFE-----
Q32UI6_E1B19K-01        ----ENASDGVSGFWRFWFASELAR------VVFRIKQDYKEEFE-----
C7SRS7_E1B19K-01        ----ENASDGVSGFWRFWFASEIAR------VVFRIKQDYKEEFE-----
J7H4R9_E1B19K-01        ----ENASDGVSGFWRFWFASELAR------VVFRIKQDYKEEFE-----
D2DM83_E1B19K-01        ----ENASDGVSGFWRFWFASELAR------VVFRIKQDYKEEFE-----
J7I6W7_E1B19K-01        ----ENASDGVSGFWRFWFASELAR------VVFRIKQDYKEEFE-----
T1UJX4_E1B19K-01        ----ENASDGVSGFWRFWFASELAR------VVFRIKQDYKEEFE-----
T2CI10_E1B19K-01        ----ENASDGVSGLWRFWFGGDLAR------LVFRIKQDYRQEFE-----
A0A0K0PX99_E1B19K-      ----ENASDGVSGLWRFWFGGDLAR------LVFRIKQDYREEFE-----
A0A0K0PX35_E1B19K-      ----ENASDGVSGLWRFWFGGDLAR------LVFRIKQDYREEFE-----
A0A220VZ73_E1B19K-      ----ENASDGVSGLWRFCFGGDLAR------LVFRIKQDYSVEFE-----
R4HLE1_E1B19K-01        ----ENASDGVSGLWRFWFGGDLAR------LVFRIKQDYREEFE-----
R4HMC6_E1B19K-01        ----ENASDGVSGLWRFWFGGDLAR------LVFRIKQDYSVEFE-----
I1V161_E1B19K-01        ----ENASDGVSGLWRFWFGGDLAR------LVFRIKQDYSVEFE-----
P03248_E1B19K-02        ----ENASDGVSGLWRFWFGGDLAR------LVFRIKQDYSVEFE-----
Q6RK98_E1B19K-01        ----ENASDGVSGLWRFWFGGDLAR------LVFRIKQDYSVEFE-----
J7I6Q4_E1B19K-01        ----ENASDGVSGLWRFWFGGDLAR------LVFRIKQDYSVEFE-----
J7I6S4_E1B19K-01        ----ENASDGVSGLWRFWFGGDLAR------LVFRIKQDYSVEFE-----
R4HLJ6_E1B19K-01        ----ENASDGVSGLWRFWFGGDLAR------LVFRIKQDYREEFE-----
R4HLA0_E1B19K-01        ----ENASDGVSGLWRFWFGGDLAR------LVFRIKQDYREEFE-----
Q2KSL3_E1B19K-01        ----ENASDGVSGLWRFWFGGDLAR------LVFRIKQDYREEFE-----
Q2Y0J3_E1B19K-01        ----ENASDGVSGLWRFWFGGDLAR------LVFRIKQDYREEFE-----
Q5EY83_E1B19K-01        ----ENASDGVSGLWRFWFGGDLAR------LVFRIKQDYREEFE-----
I6LEP5_E1B19K-01        ----ENASDGVSGLWRFWFGGDLAR------LVFRIKQDYREEFE-----
I6LES1_E1B19K-01        ----ENASDGVSGLWRFWFGGDLAR------LVFRIKQDYREEFE-----
T1UF50_E1B19K-01        ----ENASDGVSGLWRFWFGGDLAR------LVFRIKQDYREEFE-----
J7ID56_E1B19K-01        ----ENASDGVSGLWRFWFGGDLAR------LVFRIKQDYREEFE-----
A0A0B4SJH1_E1B19K-      ----ENASDGVSGFWRFWFGGDLAR------LVFRIKQDYREEFE-----
A0A075IQ70_E1B19K-      ----ENASDGVSGFWRFWFGGDLAR------LVFRIKQDYREEFE-----
Q2KS85_E1B19K-01        ----ENASDGVSGFWRFWFGGDLAR------LVFRIKQDYREEFE-----
Q3ZKW2_E1B19K-01        ----ENASDGVSGFWRFWFGGDLAR------LVFRIKQDYREEFE-----
K7NG43_E1B19K-01        ----ENASDGVSGFWRFWFGGDLAR------LVFRIKQDYREEFE-----
Q2KRU2_E1B19K-01        ----ENASDGVSGFWRFWFGGDLAR------LVFRIKQDYREEFE-----
T1UIP3_E1B19K-01        ----ENASDGVSGFWRFWFGGDLAR------LVFRIKQDYREEFE-----
Q6QPF3_E1B19K-01        ----ENSSEGVSYLWRFCFGGPLAK------LVYRAKQDYKEQFE-----
Q6QPB7_E1B19K-01        ----ENSSEGVSYLWRFCFGGPLAK------LVYRAKQDYKDQFE-----
Q6QPI9_E1B19K-01        ----ENSSEGVSYLWRFCFGGPLAK------LVYRAKQDYKDQFE-----
P10406_E1B19K-01        ----ENASNGVSHLWRFCFGGDLAK------LVYRAKQDYREQFE-----
Q5GFC7_E1B19K-01        ----ENASNGVSYLWRFCFGGDLAK------LVYRAKQDYREQFE-----
A0A2R3WN62_E1B19K-      ----ENASNGVSYLWRFCFGGDLAK------LVYRAKQDYREQFE-----
Q2KSM8_E1B19K-02        ----ENASNGVSYLWRFCFGGDLAK------LVYRTKQDYKEQFD-----
Q2KSG6_E1B19K-02        ----ENASNGVSYLWRFCFGGDLAK------LVYRTKQDYKEQFD-----
A0A2L1F392_E1B19K-      ----ENASNGVSYLWRFCFGGDLAK------LVYRTKQDYKEQFD-----
Q5GFC8_E1B19K-01        ----ENASNGVSYLWRFCFGGDLAK------LVYRAKQDYREQFE-----
Q6H1D7_E1B19K-01        ----ENASNGVSYLWRFCFGGDLAK------LVYRAKQDYREQFE-----
Q2KSG6_E1B19K-01        ----ENASNGVSYLWRFCFGGDLAK------LVYRTKQDYKEQFD-----
Q2KSM8_E1B19K-01        ----ENASNGVSYLWRFCFGGDLAK------LVYRTKQDYKEQFD-----
A0A2R3WN16_E1B19K-      ----ENASNGVSYLWRFCFGGDLAK------LVYRTKQDYKEQFD-----
A0A2L1F3A2_E1B19K-      ----ENASNGVSYLWRFCFGGDLAK------LVYRTKQDYKEQFD-----
G9G841_E1B19K-01        ----ENASNGVSHLWRFCFGGDLAK------LVYRAKQDYSEQFE-----
Q8UY91_E1B19K-01        ----ENASNGVSYLWRFCFGGDLAR------LVYRAKQDYSEQFE-----
                                           .                       :      

Q71BY5_E1B19K-01        ---------------------------QLIEEVLCLNL-SLSPSQNRNLQ
A0A384ZUF2_E1B19K-      YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYIS
A0A384ZUM9_E1B19K-      YGLEQIKTHWLNPDEDWEEAIKKYAKIALRPDCKYIVTKTVNIRHACYIS
A0A0M4NHE0_E1B19K-      ---------------------------HILSNCPGLFV-SLDLGHHTVFQ
H9AAK5_E1B19K-01        ---------------------------HILSNCPGLFV-SLDLGHHTVFQ
G0ZAH2_E1B19K-01        ---------------------------QLLQEQNRLLLNNLELGHTRALN
A0A1W5PVU4_E1B19K-      ---------------------------KLFSEVPGLVD-SLNFCHHAFFY
A0A0M3TH18_E1B19K-      ---------------------------KLFSEVPGLVD-SLNFCHHAFFY
A0A097IW62_E1B19K-      ---------------------------RLFAEVPGLLE-SLNFCHHAVFY
A0A0A1EUE4_E1B19K-      ---------------------------RLLADIPGVFV-ALDLGHHSLFQ
A0A2H5AI40_E1B19K-      ---------------------------RLLAETPGVLV-ALDLGHHSLFQ
A0A2H5AID8_E1B19K-      ---------------------------RLLAETPGVLV-ALDLGHHSLFQ
A0A2H5AII9_E1B19K-      ---------------------------RLLAETPGVLV-ALDLGHHSLFQ
A0A2H5AIL0_E1B19K-      ---------------------------RLLAETPGVLV-ALDLGHHSLFQ
A0A2H5AIN5_E1B19K-      ---------------------------RLLAETPGVLV-ALDLGHHSLFQ
A0A2H5AIS9_E1B19K-      ---------------------------RLLAETPGVLV-ALDLGHHSLFQ
A0A2H5AIT6_E1B19K-      ---------------------------RLLAETPGVLV-ALDLGHHSLFQ
A0A2H5AIU0_E1B19K-      ---------------------------RLLAETPGVLV-ALDLGHHSLFQ
A0A2H5AIC5_E1B19K-      ---------------------------RLLAETPGVLV-ALDLGHHSLFQ
D3JIR7_E1B19K-01        ---------------------------NILAGCPGLLA-SLDLCHHSIFQ
A0A076V686_E1B19K-      ---------------------------NILAGCPGLLA-SLDLCHHSIFQ
P04492_E1B19K-01        ---------------------------NILADCPGLLA-SLDLCYHLVFQ
G1DE13_E1B19K-01        ---------------------------NILTDCPGLLA-SLDLCHHSVFQ
D0Z5R9_E1B19K-01        ---------------------------NILADCPGLLA-SLDLCHHSVFQ
T1UEX7_E1B19K-01        ---------------------------NILADCPGLLA-SLDLCHHSVFQ
A0A2H5AI99_E1B19K-      ---------------------------RLLAEIPGVFV-ALDLGHHALFQ
A0A0M3TH31_E1B19K-      ---------------------------RLVADVPGLFV-SLDLGHHSYFQ
M9YXY5_E1B19K-01        ---------------------------RLVADVPGLFV-SLDLGHHSYFQ
M9YVF6_E1B19K-01        ---------------------------RLVADVPGLFV-SLDLGHHSYFQ
A0MK43_E1B19K-01        ---------------------------RLLADTPGVFV-ALDLGHHSLFQ
A0A2H5AI21_E1B19K-      ---------------------------RLLADTPGVFV-ALDLGHHSLFQ
A0A0M5L3Y4_E1B19K-      ---------------------------RLLADTPGVFV-ALDLGHHSLFQ
Q5C8R2_E1B19K-01        ---------------------------RLLADTPGVFV-ALDLGHHSLFQ
A0A0A1EUB2_E1B19K-      ---------------------------RLLADTPGVFV-ALDLGHHSLFQ
A0A0A1EUC8_E1B19K-      ---------------------------RLLADTPGVFV-ALDLGHHSLFQ
A0A2H5AI04_E1B19K-      ---------------------------RLLADTPGVFV-ALDLGHHSLFQ
A0A2H5AI72_E1B19K-      ---------------------------RLLADTPGVFV-ALDLGHHSLFQ
A0A2H5AIL3_E1B19K-      ---------------------------RLLADTPGVFV-ALDLGHHSLFQ
A0A2H4CJZ0_E1B19K-      ---------------------------ELLARYPAVFA-SLDLGHHVYFQ
H8PFZ1_E1B19K-01        ---------------------------ELLARYPAVFV-SLDLGHHVYFQ
F4ZCJ8_E1B19K-01        ---------------------------ELLSFNPGIFA-SLNLGHHSFFQ
A0A1S6ELT2_E1B19K-      ---------------------------ELLSFNPGIFA-SLNLGHHSFFQ
B5SNR1_E1B19K-01        ---------------------------ELLSFNPGIFA-SLNLGHHSFFQ
P10544_E1B19K-01        ---------------------------ELLSFNPGIFA-SLNLGHHSFFQ
W0S1G8_E1B19K-01        ---------------------------ELLSFNPGIFA-SLNLGHHSFFQ
A0A142G3J2_E1B19K-      ---------------------------DLLSHNPGIFA-SLNLGHHSFFQ
P10543_E1B19K-01        ---------------------------DLLSHNPGIFA-SLNLGHHSFFQ
Q71BY5_E1B19K-02        ---------------------------ELLKSCGELFD-SLNLGHQALFQ
E1ARN8_E1B19K-01        ---------------------------ELLKSCGELFD-SLNLGHQALFQ
A0A2H4PJ75_E1B19K-      ---------------------------ELLKSCGELFD-SLNLGHQALFQ
P03246_E1B19K-01        ---------------------------ELLKSCGELFD-SLNLGHQALFQ
Q6VGV8_E1B19K-01        ---------------------------ELLKSCGELFD-SLNLGHQALFQ
A0A0G2R248_E1B19K-      ---------------------------ELLKSCGELFD-SLNLGHQALFQ
Q6WQ37_E1B19K-01        ---------------------------ELLKSCGELFD-SLNLGHQALLQ
A0A291P1B2_E1B19K-      ---------------------------ELLKSCGELFD-SLNLGHQALFQ
T1UG63_E1B19K-01        ---------------------------ELLKSCGELFD-SLNLGHQALFQ
A0A1U9ALK7_E1B19K-      ---------------------------ELLKSCGELFD-SLNLGHQALFQ
P03247_E1B19K-01        ---------------------------ELLKSCGELFD-SLNLGHQALFQ
J9Z5H0_E1B19K-01        ---------------------------ELLKSCGELFD-SLNLGHQALFQ
J7I6T8_E1B19K-01        ---------------------------ELLKSCGELFD-SLNLGHQALFQ
J9Z4H6_E1B19K-01        ---------------------------ELLKSCGELFD-SLNLGHQALFQ
J9Z4N4_E1B19K-01        ---------------------------ELLKSCGELFD-SLNLGHQALFQ
P06501_E1B19K-01        ---------------------------RILDQCPGVFE-SLELGYHKVFE
A0A0M4N3Z1_E1B19K-      ---------------------------RILDQCPGVFE-SLELGYHKVFE
Q8B6X5_E1B19K-01        ---------------------------RILDQCPGVFE-SLELGYHKVFE
H9AAD9_E1B19K-01        ---------------------------HILSNCPGLFV-SLDLGHHTVFQ
H9AAH3_E1B19K-01        ---------------------------HILSNCPGLFV-SLDLGHHTVFQ
H9AAA8_E1B19K-01        ---------------------------HILSTCQGLFE-SLELGHHTVFQ
M9YVA3_E1B19K-01        ---------------------------HILSTCQGLFE-SLELGHHTVFQ
F2WTJ7_E1B19K-01        ---------------------------HILSTCQGLFE-SLELGHHTVFQ
F2WTM9_E1B19K-01        ---------------------------HILSTCQGLFE-SLELGHHTVFQ
H9AA76_E1B19K-01        ---------------------------HILSTCQGLFE-SLELGHHTVFQ
A0A1C8EG46_E1B19K-      ---------------------------HILSTCQGLFE-SLELGHHTVFQ
H9AAN8_E1B19K-01        ---------------------------HILSTCQGLFE-SLELGHHTVFQ
H9AAS0_E1B19K-01        ---------------------------HILSTCQGLFE-SLELGHHTVFQ
H9AAV3_E1B19K-01        ---------------------------HILSTCQGLFE-SLELGHHTVFQ
H9AAY5_E1B19K-01        ---------------------------HILSTCQGLFE-SLELGHHTVFQ
A0A1L3INW0_E1B19K-      ---------------------------QLIGLFPTIFE-SLNLGHKTLLE
F6KST6_E1B19K-01        ---------------------------ELLEHLPGLFD-SLNLGHRVLLE
F2WTG5_E1B19K-01        ---------------------------GLLEQLPGLFD-SLNLGHRTLLE
Q695T5_E1B19K-01        ---------------------------GLLEQLPGLFD-SLNLGHRTLLE
H9TER0_E1B19K-01        ---------------------------GLLEQLPGLFD-SLNLGHRTLLE
A0A0G2UY10_E1B19K-      ---------------------------NLFADCSGLLD-SLNLGHQSLFQ
X4Y9D2_E1B19K-01        ---------------------------NLFADCSGLLD-SLNLGHQSLFQ
C5HDR2_E1B19K-01        ---------------------------NLFADCSGLLD-SLNLGHQSLFQ
M0QVC7_E1B19K-01        ---------------------------NLFADCSGLLD-SLNLGHQSLFQ
Q4KSL0_E1B19K-01        ---------------------------NLFADCSGLLD-SLNLGHQSLFQ
A0A1P7YYY5_E1B19K-      ---------------------------NLFADCSGLLD-SLNFGHQSLFQ
A0A1P8C849_E1B19K-      ---------------------------NLFADCSGLLD-SLNFGHQSLFQ
B9A5L5_E1B19K-01        ---------------------------NLFADCSGLLD-SLNFGHQSLFQ
T1UGY3_E1B19K-01        ---------------------------NLFADCSGLLD-SLNFGHQSLFQ
A0A1P7YWR9_E1B19K-      ---------------------------NIFADCSGLLD-SLNFGHQSLFQ
A0A1P7YWY2_E1B19K-      ---------------------------NIFADCSCLLD-SLNFGHQSLFQ
A0A1P7YXN8_E1B19K-      ---------------------------NIFADCSCLLD-SLNFGHQSLFQ
B9A5A7_E1B19K-01        ---------------------------NLFADCSGLLD-SLNFGHQSLFQ
T1UG22_E1B19K-01        ---------------------------NLFADCSGLLD-SLNFGHQSLFQ
H5T740_E1B19K-01        ---------------------------NLFADCSGLLD-SLNLGHQALFQ
W8VNG2_E1B19K-01        ---------------------------NLFSDCSGLLD-SLNFGHQSLFQ
F8UFP5_E1B19K-01        ---------------------------NLFSDCSGLLD-SLNFGHQSLFQ
M0QV87_E1B19K-01        ---------------------------NLFSDCSGLLD-SLNFGHQSLFQ
M0QU02_E1B19K-01        ---------------------------NLFADCSGLLD-SLNFGHQSLFQ
T1UKV6_E1B19K-01        ---------------------------NLFSDCSGLLD-SLNFGHQSLFQ
M0QV47_E1B19K-01        ---------------------------NLFADCSGLLD-SLNLGHQALFQ
M0QUW8_E1B19K-01        ---------------------------NLFADCSGLLD-SLNLGHQALFQ
E1CIJ0_E1B19K-01        ---------------------------NLFADCSGLLD-SLNLGHQALFQ
T1UGU0_E1B19K-01        ---------------------------NLFADCSGLLD-SLNLGHQALFQ
M0QVG6_E1B19K-01        ---------------------------NLFVDCSGLLD-SLNLGHQALFQ
X4YVU5_E1B19K-01        ---------------------------NLFVDCSGLLD-SLNLGHQALFQ
M0QUS9_E1B19K-01        ---------------------------NLFADCSGLLD-SLNLGHQALFQ
G1FBW4_E1B19K-01        ---------------------------NLFADCSGLLD-SLNLGHQALFQ
M0QVP5_E1B19K-01        ---------------------------NLFADCSGLLD-SLNLGHQALFQ
T1UKQ0_E1B19K-01        ---------------------------NLFADCSGLLD-SLNLGHQALFQ
W8CZB0_E1B19K-01        ---------------------------NLFADCSGLLD-SLNFGHQSLFQ
G1FC01_E1B19K-01        ---------------------------NLFADCSGLLD-SLNFGHQSLFQ
G3CK71_E1B19K-01        ---------------------------NLFADCSGLLD-SLNFGHQSLFQ
T1UGT5_E1B19K-01        ---------------------------NLFADCSGLLD-SLNFGHQSLFQ
T1UK99_E1B19K-01        ---------------------------NLFADCSGLLD-SLNFGHQSLFQ
M0QTS5_E1B19K-01        ---------------------------NLFADCSGLLD-SLNFGHQSLFQ
M0QV08_E1B19K-01        ---------------------------NLFADCSGLLD-SLNFGHQSLFQ
G9JUV5_E1B19K-01        ---------------------------NLFADCSGLLD-SLNFGHQSLFQ
T1UGX3_E1B19K-01        ---------------------------NLFADCSGLLD-SLNFGHQSLFQ
T1ULJ8_E1B19K-01        ---------------------------NLFADCSGLLD-SLNLGHQALFQ
T1UHG3_E1B19K-01        ---------------------------NIFADCSGLLD-SLNLGHQSLFQ
A0A1J0MS84_E1B19K-      ---------------------------NLFADCSGLLD-SLNLGHQSLFQ
A0A097I4T0_E1B19K-      ---------------------------NLFADCSGLLD-SLNLGHQSLFQ
E9P585_E1B19K-01        ---------------------------NLFADCSGLLD-SLNLGHQSLFQ
A0A1Y1BXT7_E1B19K-      ---------------------------NIFADCSGLLD-SLNLGHQSLFQ
E5RWD9_E1B19K-01        ---------------------------NLFADCSGLLD-SLNLGHQSLFQ
M0QU76_E1B19K-01        ---------------------------NLFADCSGLLD-SLNLGHQSLFQ
T1UHL7_E1B19K-01        ---------------------------NLFADCSGLLD-SLNLGHQSLFQ
A0A075TSZ1_E1B19K-      ---------------------------NLFADCSGLLD-SLNLGHQSLFQ
T1UHH6_E1B19K-01        ---------------------------NIFADCSGLLD-SLNLGHQSLFQ
T1UKP8_E1B19K-01        ---------------------------NLFADCSGLLD-SLNLGHQSLFQ
B9A5T7_E1B19K-01        ---------------------------NLFADCSGLLD-SLNLGHQSLFQ
D3GBW3_E1B19K-01        ---------------------------NLFADCSGLLD-SLNLGHQSLFQ
M0QUF3_E1B19K-01        ---------------------------NLFADCSGLLD-SLNLGHQSLFQ
E5RWL1_E1B19K-01        ---------------------------NLFADCSGLLD-SLNLGHQSLFQ
B6C6W8_E1B19K-01        ---------------------------NLFADCSGLLD-SLNLGHQSLFQ
M0QU41_E1B19K-01        ---------------------------NLFADCSGLLD-SLNLGHQSLFQ
F1DT57_E1B19K-01        ---------------------------NLFADCSGLLD-SLNLGHQSLFQ
B2VQE3_E1B19K-01        ---------------------------NLFADCSGLLD-SLNLGHQSLFQ
B9A681_E1B19K-01        ---------------------------NLFADCSGLLD-SLNLGHQSLFQ
A0A1Y1BYF1_E1B19K-      ---------------------------NLFADCSGLLD-SLNLGHQSLFQ
B6DU90_E1B19K-01        ---------------------------NLFADCSGLLD-SLNLGHQSLFQ
T1UHZ2_E1B19K-01        ---------------------------NLFADCSGLLD-SLNLGHQSLFQ
B9A5Q1_E1B19K-01        ---------------------------NLFADCSGLLD-SLNLGHQSLFQ
M0QUB4_E1B19K-01        ---------------------------NLFADCSGLLD-SLNLGHQSLFQ
M0QUJ3_E1B19K-01        ---------------------------NIFADCSGLLD-SLNLGHQSLFQ
M0QUN2_E1B19K-01        ---------------------------NIFADCSGLLD-SLNLGHQSLFQ
C4P207_E1B19K-01        ---------------------------NLFADCSGLLD-SLNLGHQSLFQ
E1CIM6_E1B19K-01        ---------------------------NIFADCSGLLD-SLNLGHQSLFQ
D4N3H6_E1B19K-01        ---------------------------NLFADCSGLLD-SLNLGHQSLFQ
M0QVK6_E1B19K-01        ---------------------------NLFADCSGLLD-SLNLGHQSLFQ
M0QVT4_E1B19K-01        ---------------------------NLFADCSGLLD-SLNLGHQSLFQ
E1AI10_E1B19K-01        ---------------------------NIFADCSGLLD-SLNLGHQSLFQ
H0PPE7_E1B19K-01        ---------------------------NIFADCSGLLD-SLNLGHQSLFQ
Q9YL99_E1B19K-01        ---------------------------NIFADCSGLLD-SLNLGHQSLFQ
K7ZLN6_E1B19K-01        ---------------------------NIFADCSGLLD-SLNLGHQSLFQ
A0A384ZUF2_E1B19K-      ---------------------------NIFADCSGLLD-SLNLGHQSLFQ
A0A384ZUM9_E1B19K-      ---------------------------NLFADCSGLLD-SLNLGHQSLFQ
E1CIR1_E1B19K-01        ---------------------------NIFADCSGLLD-SLNLGHQSLFQ
T1UHQ8_E1B19K-01        ---------------------------NLFADCSGLLD-SLNLGHQSLFQ
T1ULP4_E1B19K-01        ---------------------------NLFADCSGLLD-SLNLGHQSLFQ
A0A291B0H2_E1B19K-      ---------------------------NLFSDCSGLLD-SLNLGHQSLFQ
Q7T951_E1B19K-01        ---------------------------KLLVDCPGLFE-ALNLGHQVHFK
T1UE63_E1B19K-01        ---------------------------KLLVDCPGLFE-ALNLGHQVHFK
Q7T8D8_E1B19K-01        ---------------------------KLLVDCPGLFE-ALNLGHQVHFK
Q8B8U7_E1B19K-01        ---------------------------KLLVDCPGLFE-ALNLGHQVHFK
Q5UW22_E1B19K-01        ---------------------------KLLVDCPGLFE-ALNLGHQVHFK
W6EIX6_E1B19K-01        ---------------------------KLLLDCPGLFE-ALNLGHQVHFK
Q3ZL02_E1B19K-01        ---------------------------KLLVDCPGLFE-ALNLGHQVHFK
A0A1L7NRH1_E1B19K-      ---------------------------KLLLDCPGLFE-ALNLGHQVHFK
T1UFS4_E1B19K-01        ---------------------------KLLVDCPGLFE-ALNLGHQVHFK
Q32UI6_E1B19K-01        ---------------------------KLLVDCPGLFE-ALNLGHQVHFK
C7SRS7_E1B19K-01        ---------------------------KLLVDCPGLFE-ALNLGHQVHFK
J7H4R9_E1B19K-01        ---------------------------KLLVDCPGLFE-ALNLGHQVHFK
D2DM83_E1B19K-01        ---------------------------KLLVDCPGLFE-ALNLGHQVHFK
J7I6W7_E1B19K-01        ---------------------------KLLVDCPGLFE-ALNLGHQVHFK
T1UJX4_E1B19K-01        ---------------------------KLLVDCPGLFE-ALNLGHQVHFK
T2CI10_E1B19K-01        ---------------------------KLLDDCPGLFE-ALNLGHQAHFK
A0A0K0PX99_E1B19K-      ---------------------------KLLDDSPGLFE-ALNLGHQAHFK
A0A0K0PX35_E1B19K-      ---------------------------KLLDDSPGLFE-ALNLGHQAHFK
A0A220VZ73_E1B19K-      ---------------------------KLLDDSPGLFE-ALNLGHQAHFK
R4HLE1_E1B19K-01        ---------------------------KLLDNSPGLFE-ALNLGHQAHFK
R4HMC6_E1B19K-01        ---------------------------KLLDDSPGLFE-ALNLGHQAHFK
I1V161_E1B19K-01        ---------------------------KLLDDSPGLFE-ALNLGHQAHFK
P03248_E1B19K-02        ---------------------------KLLDDSPGLFE-ALNLGHQAHFK
Q6RK98_E1B19K-01        ---------------------------KLLDDSPGLFE-ALNLGHQAHFK
J7I6Q4_E1B19K-01        ---------------------------KLLDDSPGLFE-ALNLGHQAHFK
J7I6S4_E1B19K-01        ---------------------------KLLDDSPGLFE-ALNLGHQAHFK
R4HLJ6_E1B19K-01        ---------------------------KLLDDSPGLFE-ALNLGHQAHFK
R4HLA0_E1B19K-01        ---------------------------KLLDDSPGLFE-ALNLGHQAHFK
Q2KSL3_E1B19K-01        ---------------------------KLLDDSPGLFE-ALNLGHQAHFK
Q2Y0J3_E1B19K-01        ---------------------------KLLDDSPGLFE-ALNLGHQAHFK
Q5EY83_E1B19K-01        ---------------------------KLLDDIPGLFE-ALNLGHQAHFK
I6LEP5_E1B19K-01        ---------------------------KLLDDSPGLFE-ALNLGHRAHFK
I6LES1_E1B19K-01        ---------------------------KLLDDSPGLFE-ALNLGHQAHFK
T1UF50_E1B19K-01        ---------------------------KLLDDSPGLFE-ALNLGHQAHFK
J7ID56_E1B19K-01        ---------------------------KLLDDSPGLFE-ALNLGHQAHFK
A0A0B4SJH1_E1B19K-      ---------------------------KLLDDSPGLFE-ALNLGHQAHFK
A0A075IQ70_E1B19K-      ---------------------------KLLDDSPGLFE-ALNLGHQAHFK
Q2KS85_E1B19K-01        ---------------------------KLLDDSPGLFE-ALNLGHQAHFK
Q3ZKW2_E1B19K-01        ---------------------------KLLDDSPGLFE-ALNLGHQAHFK
K7NG43_E1B19K-01        ---------------------------KLLDDSPGLFE-ALNLGHQAHFK
Q2KRU2_E1B19K-01        ---------------------------KLLDDSPGLFE-ALNLGHQAHFK
T1UIP3_E1B19K-01        ---------------------------KLLDDSPGLFE-ALNLGHQAHFK
Q6QPF3_E1B19K-01        ---------------------------DILRECPGIFD-SLNLGHQSHFN
Q6QPB7_E1B19K-01        ---------------------------DILRECPGIFD-SLNLGHQSHFN
Q6QPI9_E1B19K-01        ---------------------------DILRECPGIFD-SLNLGHQSHFN
P10406_E1B19K-01        ---------------------------DILRECPSLFD-ALNLGHQSHFN
Q5GFC7_E1B19K-01        ---------------------------DILRECPGLFD-ALNLGHQSHFN
A0A2R3WN62_E1B19K-      ---------------------------DILRECPGLFD-ALNLGHQSHFN
Q2KSM8_E1B19K-02        ---------------------------DILKECPGLFD-ALNLGHQSHFN
Q2KSG6_E1B19K-02        ---------------------------DILKECPGLFD-ALNLGHQSHFN
A0A2L1F392_E1B19K-      ---------------------------DILKECPGLFD-ALNLGHQSHFN
Q5GFC8_E1B19K-01        ---------------------------DILRECPGLFD-ALNLGHQSHFN
Q6H1D7_E1B19K-01        ---------------------------DILRECPGLFD-ALNLGHQSHFN
Q2KSG6_E1B19K-01        ---------------------------DILKECPGLFD-ALNLGHQSHFN
Q2KSM8_E1B19K-01        ---------------------------DILKECPGLFD-ALNLGHQSHFN
A0A2R3WN16_E1B19K-      ---------------------------DILKECPGLFD-ALNLGHQSHFN
A0A2L1F3A2_E1B19K-      ---------------------------DILKECPGLFD-ALNLGHQSHFN
G9G841_E1B19K-01        ---------------------------VILRECPGLFD-ALNLGHQTHFN
Q8UY91_E1B19K-01        ---------------------------VILRECSGLFD-ALNLGHQSHFN
                                                    :      :    :.      : 

Q71BY5_E1B19K-01        -------------DLPG------------VLKWC----------------
A0A384ZUF2_E1B19K-      GNGAEVVIDTLDKAAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLF
A0A384ZUM9_E1B19K-      GNGAEVVIDTLDKSAFRCCMMGMRAGVMNMNSMIFMNMKFNGEKFNGVLF
A0A0M4NHE0_E1B19K-      ----EKIVKALDFSSPGRAVAAIAFAAFLLDRWN-AQTQLSPG-------
H9AAK5_E1B19K-01        ----EKIVKALDFSSPGRAVAAIAFAAFLLDRWN-AQTQLSPG-------
G0ZAH2_E1B19K-01        ----G-VLRELDFENTGRVVAGLAFLAYLLDRWD-ENSVLSPG-------
A0A1W5PVU4_E1B19K-      ----EKVICGLDFCTPGRTIAALAFCAFILDKWN-KETHLSRG-------
A0A0M3TH18_E1B19K-      ----EKVICGLDFCTPGRTIAALAFCAFILDKWN-KETHLSKG-------
A0A097IW62_E1B19K-      ----EKIICSLDFCTPGRTIAALAFCTYILDRWN-KETHLSAG-------
A0A0A1EUE4_E1B19K-      ----EKIVKSLTFSSPGRTVVSAAFITYILDQWSSSGSHLSWD-------
A0A2H5AI40_E1B19K-      ----EKIIRNLTFSSPGRTVASAAFVAYILDQWSNSNSHLSWE-------
A0A2H5AID8_E1B19K-      ----EKIIRNLTFSSPGRTVASAAFVAYILDQWSNSDSHLSWE-------
A0A2H5AII9_E1B19K-      ----EKIIRNLTFSSPGRTVASAAFVAYILDQWSNSNSHLSWE-------
A0A2H5AIL0_E1B19K-      ----EKIIRNLTFSSPGRTVASAAFVAYILDQWSNSDSHLSWE-------
A0A2H5AIN5_E1B19K-      ----EKIIRNLTFSSPGRTVASAAFVAYILDQWSNSNSHLSWE-------
A0A2H5AIS9_E1B19K-      ----EKIIRNLTFSSPGRTVASAAFVAYILDQWSNSDSHLSWE-------
A0A2H5AIT6_E1B19K-      ----EKIIRNLTFSSPGRTVASAAFVAYILDQWSNSDSHLSWE-------
A0A2H5AIU0_E1B19K-      ----EKIIRNLTFSSPGRTVASAAFVAYILDQWSNSNSHLSWE-------
A0A2H5AIC5_E1B19K-      ----EKIIRNLTFSSPGRTVASAAFITYILDQWSNSDSHLSWE-------
D3JIR7_E1B19K-01        ----EKVVKSLDFSSAGRTVASIAFLVTVLDKWS-QTSQLSWD-------
A0A076V686_E1B19K-      ----EKVVRSLDFSSAGRTVASIAFLVTVLDKWS-QASQLSWD-------
P04492_E1B19K-01        ----EKVVRSLDFSSVGRTVASIAFLATILDKWS-EKSHLSWD-------
G1DE13_E1B19K-01        ----ERVVRSLDFSSSGRTVASIAFLVTVLDKWS-ERSHLSWD-------
D0Z5R9_E1B19K-01        ----ERVVRSLDFSSSGRTVASIAFLATVLDKWS-ERSHLSWD-------
T1UEX7_E1B19K-01        ----ERVVRSLDFSSSGRTVASIAFLATVLDKWS-ERSHLSWD-------
A0A2H5AI99_E1B19K-      ----EKVIKSLTFSSPGRVVTSLAFICHLLDKWS-SDSHLSWN-------
A0A0M3TH31_E1B19K-      ----EKIVKGLVFESTGRTVVSVAFICFLLDKWS-SDSHLSWD-------
M9YXY5_E1B19K-01        ----EKIVKGLVFESTGRTVVSVAFICFLLDKWS-SDSHLSWD-------
M9YVF6_E1B19K-01        ----EKIVKGLVFESTGRTVVSVAFICFLLDKWS-SDSHLSWD-------
A0MK43_E1B19K-01        ----EKIIKNLTFTSPGRTVASAAFITYILDQWSNSDSHLSWE-------
A0A2H5AI21_E1B19K-      ----EKIIKNLTFTSPGRTVASAAFITYILDQWSNSDSHLSWE-------
A0A0M5L3Y4_E1B19K-      ----EKIIKNLTFTSPGRTVASAAFITYILDQWSNSDSHLSWE-------
Q5C8R2_E1B19K-01        ----EKIIKNLTFTSPGRTVASAAFITYILDQWSNSDSHLSWE-------
A0A0A1EUB2_E1B19K-      ----EKIIKNLTFTSPGRTVASAAFITYILDQWSNSGSHLSWE-------
A0A0A1EUC8_E1B19K-      ----EKIIKNLTFTSPGRTVASAAFITYILDQWSNSGSHLSWE-------
A0A2H5AI04_E1B19K-      ----EKIIKNLTFTSPGRTVASAAFITYILDQWSNSGSHLSWE-------
A0A2H5AI72_E1B19K-      ----EKIIKNLTFTSPGRTVASAAFITYILDQWSNSGSHLSWE-------
A0A2H5AIL3_E1B19K-      ----EKIIKNLTFTSPGRTVASAAFITYILDQWSNSGSHLSWE-------
A0A2H4CJZ0_E1B19K-      ----EAVVRYLDFSTPGRTVSALAFICFVLDRWS-AQTRLSPG-------
H8PFZ1_E1B19K-01        ----EAVVRYLDFSTPGRAVSAIAFICFVLDRWS-AQTRLSPG-------
F4ZCJ8_E1B19K-01        ----EIVIKNLDFSSPGRTVSGLAFICFILDQWS-AQTHLSEG-------
A0A1S6ELT2_E1B19K-      ----EIVIKNLDFSSPGRTVSGLAFICFILDQWS-AQTHLSEG-------
B5SNR1_E1B19K-01        ----EIVIKNLDFSSPGRTVSGLAFICFILDQWS-AQTHLSEG-------
P10544_E1B19K-01        ----EIVIKNLDFSSPGRTVSGLAFICFILDQWS-AQTHLSEG-------
W0S1G8_E1B19K-01        ----EIVIKNLDFSSPGRTVSGLAFICFILDQWS-AQTHLSEG-------
A0A142G3J2_E1B19K-      ----EIVIRNLDFSSPGRTVSGLAFICFILDQWS-AQTHLSQG-------
P10543_E1B19K-01        ----EIVIRNLDFSSPGRTVSGLAFICFILDQWS-AQTHLSQG-------
Q71BY5_E1B19K-02        ----EKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSGG-------
E1ARN8_E1B19K-01        ----EKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSGG-------
A0A2H4PJ75_E1B19K-      ----EKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSGG-------
P03246_E1B19K-01        ----EKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSGG-------
Q6VGV8_E1B19K-01        ----EKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSGG-------
A0A0G2R248_E1B19K-      ----EKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSGG-------
Q6WQ37_E1B19K-01        ----EKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSGG-------
A0A291P1B2_E1B19K-      ----EKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSGG-------
T1UG63_E1B19K-01        ----EKVIKTLDFSTPGRTAAAVAFLSFIKDKWS-EETHLSGG-------
A0A1U9ALK7_E1B19K-      ----EKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSGG-------
P03247_E1B19K-01        ----EKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSGG-------
J9Z5H0_E1B19K-01        ----EKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSGG-------
J7I6T8_E1B19K-01        ----EKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSGG-------
J9Z4H6_E1B19K-01        ----EKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSGG-------
J9Z4N4_E1B19K-01        ----EKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSGG-------
P06501_E1B19K-01        ----EKIVKELDFSSPGRAVAAVAFASYLLDRWN-TRTHLSPG-------
A0A0M4N3Z1_E1B19K-      ----DKIVKELDFSSPGRAVAAVAFASYLLDRWN-TRTHLSPG-------
Q8B6X5_E1B19K-01        ----DKIVKELDFSSPGRAVAAVAFASYLLDRWN-TRTHLSPG-------
H9AAD9_E1B19K-01        ----EKIVKALDFSSPGRAVAAIAFAAFLLDRWN-AQTQLSPG-------
H9AAH3_E1B19K-01        ----EKIVKALDFSSPGRAVAAIAFAAFLLDRWN-AQTQLSPG-------
H9AAA8_E1B19K-01        ----EKIVKALDFSSPGRAVAAIAFAAFILDRWN-TQTQLSPG-------
M9YVA3_E1B19K-01        ----EKIVKALDFSSPGRAVAAIAFAAFILDRWN-TQTQLSPG-------
F2WTJ7_E1B19K-01        ----EKIVKALDFSSPGRAVAAIAFAAFILDRWN-SQTQLSPG-------
F2WTM9_E1B19K-01        ----EKIVKALDFSSPGRAVAAIAFAAFILDRWN-SQTQLSPG-------
H9AA76_E1B19K-01        ----EKIVKALDFSSPGRAVAAIAFAAFILDRWN-TQTQLSPG-------
A0A1C8EG46_E1B19K-      ----EKIVKALDFSSPGRAVAAIAFAAFILDRWN-TQTQLSPG-------
H9AAN8_E1B19K-01        ----EKIVKALDFSSPGRAVAAIAFAAFILDRWN-TQTQLSPG-------
H9AAS0_E1B19K-01        ----EKIVKALDFSSPGRAVAAIAFAAFILDRWN-TQTQLSPG-------
H9AAV3_E1B19K-01        ----EKIVKALDFSSPGRAVAAIAFAAFILDRWN-TQTQLSPG-------
H9AAY5_E1B19K-01        ----EKIVKALDFSSPGRAVAAIAFAAFILDRWN-TQTQLSPG-------
A0A1L3INW0_E1B19K-      ----DKLLVQLDFSTPGRACSGLAFVVHLLDRWN-QETYLSPG-------
F6KST6_E1B19K-01        ----ERLFPQLDFSSPGRLCSALAFVVHLLDRWN-EQTQLSPG-------
F2WTG5_E1B19K-01        ----ERLFPQLDFSSPGRLCSALAFAVHLLDRWN-EQTQLSPG-------
Q695T5_E1B19K-01        ----ERLFPQLDFSSPGRLCSALAFAVHLLDRWN-EQTQLSPG-------
H9TER0_E1B19K-01        ----ERLFPQLDFSSPGRLCSALAFAVHLLDRWN-EQTQLSPG-------
A0A0G2UY10_E1B19K-      ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRG-------
X4Y9D2_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWR-QDTQLSRG-------
C5HDR2_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRG-------
M0QVC7_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRG-------
Q4KSL0_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
A0A1P7YYY5_E1B19K-      ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
A0A1P8C849_E1B19K-      ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
B9A5L5_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
T1UGY3_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
A0A1P7YWR9_E1B19K-      ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
A0A1P7YWY2_E1B19K-      ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
A0A1P7YXN8_E1B19K-      ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
B9A5A7_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
T1UG22_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
H5T740_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QQTHLTRD-------
W8VNG2_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRG-------
F8UFP5_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRG-------
M0QV87_E1B19K-01        ----ERVLHSLDFSTPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
M0QU02_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
T1UKV6_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
M0QV47_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QQTHLTRD-------
M0QUW8_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QQTHLTRD-------
E1CIJ0_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QQTHLTRD-------
T1UGU0_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QQTHLTRD-------
M0QVG6_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QQTHLTRD-------
X4YVU5_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QQTHLTRD-------
M0QUS9_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
G1FBW4_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QQTHLTRD-------
M0QVP5_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QQTHLTRD-------
T1UKQ0_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QQTHLTRD-------
W8CZB0_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRG-------
G1FC01_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRG-------
G3CK71_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRG-------
T1UGT5_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRG-------
T1UK99_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QQTHLTRD-------
M0QTS5_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRG-------
M0QV08_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRG-------
G9JUV5_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRG-------
T1UGX3_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRG-------
T1ULJ8_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
T1UHG3_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
A0A1J0MS84_E1B19K-      ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRG-------
A0A097I4T0_E1B19K-      ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRG-------
E9P585_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
A0A1Y1BXT7_E1B19K-      ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
E5RWD9_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVACVVFLVDKWS-QNTQLSRG-------
M0QU76_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRG-------
T1UHL7_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
A0A075TSZ1_E1B19K-      ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
T1UHH6_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
T1UKP8_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
B9A5T7_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRG-------
D3GBW3_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRG-------
M0QUF3_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRG-------
E5RWL1_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRG-------
B6C6W8_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRG-------
M0QU41_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRG-------
F1DT57_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRG-------
B2VQE3_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRG-------
B9A681_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRG-------
A0A1Y1BYF1_E1B19K-      ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRG-------
B6DU90_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRG-------
T1UHZ2_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRG-------
B9A5Q1_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
M0QUB4_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
M0QUJ3_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
M0QUN2_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
C4P207_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
E1CIM6_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
D4N3H6_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
M0QVK6_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
M0QVT4_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
E1AI10_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
H0PPE7_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
Q9YL99_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
K7ZLN6_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
A0A384ZUF2_E1B19K-      ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
A0A384ZUM9_E1B19K-      ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
E1CIR1_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
T1UHQ8_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
T1ULP4_E1B19K-01        ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
A0A291B0H2_E1B19K-      ----ERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRG-------
Q7T951_E1B19K-01        ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSRG-------
T1UE63_E1B19K-01        ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSRG-------
Q7T8D8_E1B19K-01        ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSRG-------
Q8B8U7_E1B19K-01        ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSRG-------
Q5UW22_E1B19K-01        ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSRG-------
W6EIX6_E1B19K-01        ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSRG-------
Q3ZL02_E1B19K-01        ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSRG-------
A0A1L7NRH1_E1B19K-      ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSRG-------
T1UFS4_E1B19K-01        ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSRG-------
Q32UI6_E1B19K-01        ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSRG-------
C7SRS7_E1B19K-01        ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSRG-------
J7H4R9_E1B19K-01        ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSRG-------
D2DM83_E1B19K-01        ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSRG-------
J7I6W7_E1B19K-01        ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSRG-------
T1UJX4_E1B19K-01        ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSRG-------
T2CI10_E1B19K-01        ----EKVLSVLDFSTPGRTAAAVAFLTFIFDKWI-PQTHFSKG-------
A0A0K0PX99_E1B19K-      ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSRG-------
A0A0K0PX35_E1B19K-      ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKG-------
A0A220VZ73_E1B19K-      ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKG-------
R4HLE1_E1B19K-01        ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKG-------
R4HMC6_E1B19K-01        ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKG-------
I1V161_E1B19K-01        ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKG-------
P03248_E1B19K-02        ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKG-------
Q6RK98_E1B19K-01        ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKG-------
J7I6Q4_E1B19K-01        ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKG-------
J7I6S4_E1B19K-01        ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKG-------
R4HLJ6_E1B19K-01        ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKG-------
R4HLA0_E1B19K-01        ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKG-------
Q2KSL3_E1B19K-01        ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKG-------
Q2Y0J3_E1B19K-01        ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKG-------
Q5EY83_E1B19K-01        ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKG-------
I6LEP5_E1B19K-01        ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKG-------
I6LES1_E1B19K-01        ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKG-------
T1UF50_E1B19K-01        ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKG-------
J7ID56_E1B19K-01        ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKG-------
A0A0B4SJH1_E1B19K-      ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKG-------
A0A075IQ70_E1B19K-      ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKG-------
Q2KS85_E1B19K-01        ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKG-------
Q3ZKW2_E1B19K-01        ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKG-------
K7NG43_E1B19K-01        ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKG-------
Q2KRU2_E1B19K-01        ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKG-------
T1UIP3_E1B19K-01        ----EKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKG-------
Q6QPF3_E1B19K-01        ----QSILRALDFSTPGRTTAAVAFFAFILDKWS-QETHFSRD-------
Q6QPB7_E1B19K-01        ----QSILRALDFSTPGRTTAAVAFFAFILDKWS-QETHFSRD-------
Q6QPI9_E1B19K-01        ----QSILRALDFSTPGRTTAAVAFFAFILDKWS-QETHFSRD-------
P10406_E1B19K-01        ----QRISRALDFTTPGRTTAAVAFFAFIFDKWS-QETHFSRD-------
Q5GFC7_E1B19K-01        ----QRISRALDFTTPGRTTAAVAFFAFIFDKWS-QETHFSRD-------
A0A2R3WN62_E1B19K-      ----QRISRALDFTTPGRTTAAVAFFAFIFDKWS-QETHFSRD-------
Q2KSM8_E1B19K-02        ----QRISRALDFTTPGRTTAAVAFFAFVLDKWS-QETHFSRD-------
Q2KSG6_E1B19K-02        ----QRISRALDFTTPGRTTAAVAFFAFVLDKWS-QETHFSRD-------
A0A2L1F392_E1B19K-      ----QRISRALDFTTPGRTTAAVAFFAFVLDKWS-QETHFSRD-------
Q5GFC8_E1B19K-01        ----QRISRALDFTTPGRTTAAVAFFAFIFDKWS-QETHFSRD-------
Q6H1D7_E1B19K-01        ----QRISRALDFTTPGRTTAAVAFFAFIFDKWS-QETHFSRD-------
Q2KSG6_E1B19K-01        ----QRISRALDFTTPGRTTAAVAFFAFVLDKWS-QETHFSRD-------
Q2KSM8_E1B19K-01        ----QRISRALDFTTPGRTTAAVAFFAFVLDKWS-QETHFSRD-------
A0A2R3WN16_E1B19K-      ----QRISRALDFTTPGRTTAAVAFFAFVLDKWS-QETHFSRD-------
A0A2L1F3A2_E1B19K-      ----QRISRALDFTTPGRTTAAVAFFAFVLDKWS-QETHFSRD-------
G9G841_E1B19K-01        ----QRIVRALDFTTPGRSTAAVAFFAFLLDKWS-QETHFSRD-------
Q8UY91_E1B19K-01        ----QRISRALDFTTPGRTTAAVAFFAFILDKWS-QETHFSRD-------
                                                                          

Q71BY5_E1B19K-01        --------------------------------------------------
A0A384ZUF2_E1B19K-      MANSHMTLHGCSFFGFNNMCAEVWGASKI----------RGCKFYGCWMG
A0A384ZUM9_E1B19K-      MANSHMTLHGCSFFGFNNMCAEVWGAAKI----------RGCKFYGCWMG
A0A0M4NHE0_E1B19K-      -------------YTLDYISLQLWRFWLRR------------RVYNYSR-
H9AAK5_E1B19K-01        -------------YTLDYISLQLWRFWLRR------------RVYNYSR-
G0ZAH2_E1B19K-01        -------------YRLDCLALAIWKHTLREGILRGVMQGPRARVNREIR-
A0A1W5PVU4_E1B19K-      -------------YTLDYISLQLWKAYMRK---------G---KIYTFS-
A0A0M3TH18_E1B19K-      -------------YTLDYISLQLWKAYMRK---------GKIYTFSQGP-
A0A097IW62_E1B19K-      -------------YTLDYITLQLWKAYMRK---------GKIYTFSREP-
A0A0A1EUE4_E1B19K-      -------------YMLDYLAMALWRAMLRR---------R---VCIYSR-
A0A2H5AI40_E1B19K-      -------------YMLDYMAMALWRAMLRR---------R---VCIYLR-
A0A2H5AID8_E1B19K-      -------------YMLDYMAMALWRAMLRR---------R---VCIYLR-
A0A2H5AII9_E1B19K-      -------------YMLDYMAMALWRAMLRR---------R---VCIYLR-
A0A2H5AIL0_E1B19K-      -------------YMLDYMAMALWRAMLRR---------R---VCIYLR-
A0A2H5AIN5_E1B19K-      -------------YMLDYMAMALWRAMLRR---------R---VCIYLR-
A0A2H5AIS9_E1B19K-      -------------YMLDYMAMALWRAMLRR---------R---VCIYLR-
A0A2H5AIT6_E1B19K-      -------------YMLDYMAMALWRAMLRR---------R---VCIYLR-
A0A2H5AIU0_E1B19K-      -------------YMLDYMAMALWRAMLRR---------R---VCIYLR-
A0A2H5AIC5_E1B19K-      -------------YMLDYMAMALWRAMLRR---------R---VCIYLR-
D3JIR7_E1B19K-01        -------------YMLDYMAMQLWRAWLTR---------R--VCI-YSL-
A0A076V686_E1B19K-      -------------YMLDYMTMQLWRAWLTR---------R--VCI-YSL-
P04492_E1B19K-01        -------------YMLDYMSMQLWRAWLKR---------R--VCI-YSL-
G1DE13_E1B19K-01        -------------YMLDYMAMHLWRAWLKR---------R--VCI-YSL-
D0Z5R9_E1B19K-01        -------------YMLDYMAMHLWRAWLKR---------R--VCI-YSL-
T1UEX7_E1B19K-01        -------------YMLDYMAMHLWRAWLKR---------R--VCI-YSL-
A0A2H5AI99_E1B19K-      -------------YMLDYLSMAVWRAML-R---------K--RVCIYLR-
A0A0M3TH31_E1B19K-      -------------YMLDYMTMALWRALLRR---------R--RACIYLP-
M9YXY5_E1B19K-01        -------------YMLDYMTMALWRALLRR---------R--RACIYLP-
M9YVF6_E1B19K-01        -------------YMLDYMTMALWRALLRR---------R--RACIYLP-
A0MK43_E1B19K-01        -------------YMLDYMAMALWRAMLRR---------R--VCI-YLR-
A0A2H5AI21_E1B19K-      -------------YMLDYMAMALWRAMLRR---------R--VCI-YLR-
A0A0M5L3Y4_E1B19K-      -------------YMLDYMAMALWRAMLRR---------R--VCI-YLR-
Q5C8R2_E1B19K-01        -------------YMLDYMAMALWRAMLRR---------R--VCI-YLR-
A0A0A1EUB2_E1B19K-      -------------YMLDYMSMALWRAMLRR---------R--VCI-YLR-
A0A0A1EUC8_E1B19K-      -------------YMLDYMSMALWRAMLRR---------R--VCI-YLR-
A0A2H5AI04_E1B19K-      -------------YMLDYMSMALWRAMLRR---------R--VCI-YLR-
A0A2H5AI72_E1B19K-      -------------YMLDYMSMALWRAMLRR---------R--VCI-YLR-
A0A2H5AIL3_E1B19K-      -------------YMLDYMSMALWRAMLRR---------R--VCI-YLR-
A0A2H4CJZ0_E1B19K-      -------------YTLDYLTMSLWRAMLRK---------R--RVSGFSP-
H8PFZ1_E1B19K-01        -------------YTLDYLTMSLWRAMLRK---------R--RVSGFSP-
F4ZCJ8_E1B19K-01        -------------YTLDYMTMALWRTLLRR---------K--RVLGCSP-
A0A1S6ELT2_E1B19K-      -------------YTLDYMTMALWRTLLRR---------K--RVLGCSP-
B5SNR1_E1B19K-01        -------------YTLDYMTMALWRTLLRR---------K--RVLGCSP-
P10544_E1B19K-01        -------------YTLDYMTMALWRTLLRR---------K--RVLGCSP-
W0S1G8_E1B19K-01        -------------YTLDYMTMALWRTLLRR---------K--RVLGCSP-
A0A142G3J2_E1B19K-      -------------YTLDYMAMALWRTLLRR---------K--RVLGCLP-
P10543_E1B19K-01        -------------YTLDYMAMALWRTLLRR---------K--RVLGCLP-
Q71BY5_E1B19K-02        -------------YLLDFLAMHLWRAVVRH---------K-----NRLL-
E1ARN8_E1B19K-01        -------------YLLDFLAMHLWRAVVRH---------K-----NRLL-
A0A2H4PJ75_E1B19K-      -------------YLLDFLAMHLWRAVVRH---------K-----NRLL-
P03246_E1B19K-01        -------------YLLDFLAMHLWRAVVRH---------K-----NRLL-
Q6VGV8_E1B19K-01        -------------YLLDFLAMHLWRAVVRH---------K-----NRLL-
A0A0G2R248_E1B19K-      -------------YLLDFLAMHLWRAVVRH---------K-----NRLL-
Q6WQ37_E1B19K-01        -------------YLLDFLAMHLWRAVVRH---------K-----NRLL-
A0A291P1B2_E1B19K-      -------------YLLDFLAMHLWRAVVRH---------K-----NRLL-
T1UG63_E1B19K-01        -------------YLLDFLAMHLWRAVVRH---------K-----NRLL-
A0A1U9ALK7_E1B19K-      -------------YLLDFLAMHLWRAVVRH---------K-----NRLL-
P03247_E1B19K-01        -------------YLLDFLAMHLWRAVVRH---------K-----NRLL-
J9Z5H0_E1B19K-01        -------------YLLDFLAMHLWRAVVRH---------K-----NRLL-
J7I6T8_E1B19K-01        -------------YLLDFLAMHLWRAVVRH---------K-----NRLL-
J9Z4H6_E1B19K-01        -------------YLLDFLAMHLWRAVVRH---------K-----NRLL-
J9Z4N4_E1B19K-01        -------------YLLDFLAMHLWRAVVRH---------K-----NRLL-
P06501_E1B19K-01        -------------YQMDYISLNLWKFWLRR---------RVYNYSRGL--
A0A0M4N3Z1_E1B19K-      -------------YQMDYISLNLWKFWLRR---------RVYNYSRGL--
Q8B6X5_E1B19K-01        -------------YQMDYIRLNLWKFWLRR---------RVYNYSRGL--
H9AAD9_E1B19K-01        -------------YTLDYISLQLWRFWLRR---------RVYNYSRGL--
H9AAH3_E1B19K-01        -------------YTLDYISLQLWRFWLRR---------RVYNYSRGL--
H9AAA8_E1B19K-01        -------------YTLDYISLQLWRFWLRR---------RVYNYSRGL--
M9YVA3_E1B19K-01        -------------YTLDYISLQLWRFWLRR---------RVYNYSRGL--
F2WTJ7_E1B19K-01        -------------YTLDYISLQLWRFWLRR---------RVYNYSRGL--
F2WTM9_E1B19K-01        -------------YTLDYISLQLWRFWLRR---------RVYNYSRGL--
H9AA76_E1B19K-01        -------------YTLDYISLQLWRFWLRR---------RVYNYSRGL--
A0A1C8EG46_E1B19K-      -------------YTLDYISLQLWRFWLRR---------RVYNYSRGL--
H9AAN8_E1B19K-01        -------------YTLDYISLQLWRFWLRR---------RVYNYSRGL--
H9AAS0_E1B19K-01        -------------YTLDYISLQLWRFWLRR---------RVYNYSRGL--
H9AAV3_E1B19K-01        -------------YTLDYISLQLWRFWLRR---------RVYNYSRGL--
H9AAY5_E1B19K-01        -------------YTLDYISLQLWRFWLRR---------RVYNYSRGL--
A0A1L3INW0_E1B19K-      -------------YTLDFLTLSLWKTGLKR---------GRKLYGRMLE-
F6KST6_E1B19K-01        -------------YTLDFLTLCLWKFGIRK---------GRKLYRRLVE-
F2WTG5_E1B19K-01        -------------YTLDFLTLCLWKFGIRR---------GRKLYGRLVE-
Q695T5_E1B19K-01        -------------YTLDFLTLCLWKFGIRR---------GRKLYGRLVE-
H9TER0_E1B19K-01        -------------YTLDFLTLCLWKFGIRR---------GRKLYGRLVE-
A0A0G2UY10_E1B19K-      -------------YILDFAAMHLWRSWIRQ---------RGQRILNYWL-
X4Y9D2_E1B19K-01        -------------YILDFAAMHLWRSWIRQ---------RGQRILNYWL-
C5HDR2_E1B19K-01        -------------YILDFAAMHLWRAWVRQ---------RGQRILNYWL-
M0QVC7_E1B19K-01        -------------YILDFAAMHLWRAWVRQ---------RGQRILNYWL-
Q4KSL0_E1B19K-01        -------------YILDFAAMHLWRAWIRQ---------RGQRILNYWL-
A0A1P7YYY5_E1B19K-      -------------YILDFAAMHLWRAWMRQ---------RGQRILNYWL-
A0A1P8C849_E1B19K-      -------------YILDFAAMHLWRAWMRQ---------RGQRILNYWL-
B9A5L5_E1B19K-01        -------------YILDFAAMHLWRAWMRQ---------RGQRILNYWL-
T1UGY3_E1B19K-01        -------------YILDFAAMHLWRAWMRQ---------RGQRILNYWL-
A0A1P7YWR9_E1B19K-      -------------YILDFAAMHLWRAWMRQ---------RGQRILNYWL-
A0A1P7YWY2_E1B19K-      -------------YILDFAAMHLWRAWMRQ---------RGQRILNYWL-
A0A1P7YXN8_E1B19K-      -------------YILDFAAMHLWRAWMRQ---------RGQRILNYWL-
B9A5A7_E1B19K-01        -------------YILDFAAMHLWRAWMRQ---------RGQRILNYWL-
T1UG22_E1B19K-01        -------------YILDFAAMHLWRAWMRQ---------RGQRILNYWL-
H5T740_E1B19K-01        -------------YILDFTAMHLWKAWVRQ---------RGQRILNYWL-
W8VNG2_E1B19K-01        -------------YILDFAAMHLWRAWIRQ---------RGQRILNYWL-
F8UFP5_E1B19K-01        -------------YILDFAAMHLWRAWIRQ---------RGQRILNYWL-
M0QV87_E1B19K-01        -------------YILDFAAMHLWRAWIRQ---------RGQRILNYWL-
M0QU02_E1B19K-01        -------------YILDFAAMHLWRAWIRQ---------RGQRILNYWL-
T1UKV6_E1B19K-01        -------------YILDFAAMHLWRAWIRQ---------RGQRILNYWL-
M0QV47_E1B19K-01        -------------YILDFTAMHLWKAWVRQ---------RGQRILNYWL-
M0QUW8_E1B19K-01        -------------YILDFTAMHLWKAWVRQ---------RGQRILNYWL-
E1CIJ0_E1B19K-01        -------------YILDFTAMHLWKAWVRQ---------RGQRILNYWL-
T1UGU0_E1B19K-01        -------------YILDFTAMHLWKAWVRQ---------RGQRILNYWL-
M0QVG6_E1B19K-01        -------------YILDFTAMHLWKAWVRQ---------RGQRILNYWL-
X4YVU5_E1B19K-01        -------------YILDFTAMHLWKAWVRQ---------RGQRILNYWL-
M0QUS9_E1B19K-01        -------------YILDFTAMHLWRAWVRQ---------RGQRILNYWL-
G1FBW4_E1B19K-01        -------------YILDFTAMHLWKAWVRQ---------RGQRILNYWL-
M0QVP5_E1B19K-01        -------------YILDFTAMHLWKAWVRQ---------RGQRILNYWL-
T1UKQ0_E1B19K-01        -------------YILDFTAMHLWKAWVRQ---------RGQRILNYWL-
W8CZB0_E1B19K-01        -------------YILDFAAMHLWRAWVRQ---------RGQRILNYWL-
G1FC01_E1B19K-01        -------------YILDFAAMHLWRAWVRQ---------RGQRILNYWL-
G3CK71_E1B19K-01        -------------YILDFAAMHLWRAWVRQ---------RGQRILNYWL-
T1UGT5_E1B19K-01        -------------YILDFAAMHLWRAWVRQ---------RGQRILNYWL-
T1UK99_E1B19K-01        -------------YILDFTAMHLWKAWVRQ---------RGQRILNYWL-
M0QTS5_E1B19K-01        -------------YILDFAAMHLWRAWVRQ---------RGQRILNYWL-
M0QV08_E1B19K-01        -------------YILDFAAMHLWRAWVRQ---------RGQRILNYWL-
G9JUV5_E1B19K-01        -------------YILDFAAMHLWRAWVRQ---------RGQRILNYWL-
T1UGX3_E1B19K-01        -------------YILDFAAMHLWRAWVRQ---------RGQRILNYWL-
T1ULJ8_E1B19K-01        -------------YILDFAAMHLWRAWIRQ---------RGQRILNYWL-
T1UHG3_E1B19K-01        -------------YILDFAAMHLWRAWIRQ---------RGQRILNYWL-
A0A1J0MS84_E1B19K-      -------------YILDFAAMHLWRSWVRQ---------RGQRILNYWL-
A0A097I4T0_E1B19K-      -------------YILDFAAMHLWRAWVRQ---------RGQRILNYWL-
E9P585_E1B19K-01        -------------YILDFAAMHLWRAWIRQ---------RGQRILNYWL-
A0A1Y1BXT7_E1B19K-      -------------YILDFAAMHLWRAWIRQ---------RGQKILNYWL-
E5RWD9_E1B19K-01        -------------YILDFAAMHLWRAWVRQ---------RGQRILNYWL-
M0QU76_E1B19K-01        -------------YILDFAAMHLWRAWVRQ---------RGQRILNYWL-
T1UHL7_E1B19K-01        -------------YILDFAAMHLWRSWIRQ---------RGQRILNYWL-
A0A075TSZ1_E1B19K-      -------------YILDFAAMHLWRSWIRQ---------RGQRILNYWL-
T1UHH6_E1B19K-01        -------------YILDFAAMHLWRSWIRQ---------RGQRILNYWL-
T1UKP8_E1B19K-01        -------------YILDFAAMHLWRSWIRQ---------RGQRILNYWL-
B9A5T7_E1B19K-01        -------------YILDFAAMHLWRAWVRQ---------RGQRILNYWL-
D3GBW3_E1B19K-01        -------------YILDFAAMHLWRAWVRQ---------RGQRILNYWL-
M0QUF3_E1B19K-01        -------------YILDFAAMHLWRAWVRQ---------RGQRILNYWL-
E5RWL1_E1B19K-01        -------------YILDFAAMHLWRAWVRQ---------RGQRILNYWL-
B6C6W8_E1B19K-01        -------------YILDFAAMHLWRAWVRQ---------RGQRILNYWL-
M0QU41_E1B19K-01        -------------YILDFAAMHLWRAWVRQ---------RGQRILNYWL-
F1DT57_E1B19K-01        -------------YILDFAAMHLWRAWVRQ---------RGQRILNYWL-
B2VQE3_E1B19K-01        -------------YILDFAAMHLWRAWVRQ---------RGQRILNYWL-
B9A681_E1B19K-01        -------------YILDFAAMHLWRAWVRQ---------RGQRILNYWL-
A0A1Y1BYF1_E1B19K-      -------------YILDFAAMHLWRAWVRQ---------RGQRILNYWL-
B6DU90_E1B19K-01        -------------YILDFAAMHLWRAWVRQ---------RGQRILNYWL-
T1UHZ2_E1B19K-01        -------------YILDFAAMHLWRAWVRQ---------RGQRILNYWL-
B9A5Q1_E1B19K-01        -------------YILDFAAMHLWRAWIRQ---------RGQRILNYWL-
M0QUB4_E1B19K-01        -------------YILDFAAMHLWRAWIRQ---------RGQRILNYWL-
M0QUJ3_E1B19K-01        -------------YILDFAAMHLWRAWIRQ---------RGQRILNYWL-
M0QUN2_E1B19K-01        -------------YILDFAAMHLWRAWIRQ---------RGQRILNYWL-
C4P207_E1B19K-01        -------------YILDFAAMHLWRAWIRQ---------RGQRILNYWL-
E1CIM6_E1B19K-01        -------------YILDFAAMHLWRAWIRQ---------RGQRILNYWL-
D4N3H6_E1B19K-01        -------------YILDFAAMHLWRAWIRQ---------RGQRILNYWL-
M0QVK6_E1B19K-01        -------------YILDFAAMHLWRAWIRQ---------RGQRILNYWL-
M0QVT4_E1B19K-01        -------------YILDFAAMHLWRAWIRQ---------RGQRILNYWL-
E1AI10_E1B19K-01        -------------YILDFAAMHLWRAWIRQ---------RGQRILNYWL-
H0PPE7_E1B19K-01        -------------YILDFAAMHLWRAWIRQ---------RGQRILNYWL-
Q9YL99_E1B19K-01        -------------YILDFAAMHLWRAWIRQ---------RGQRILNYWL-
K7ZLN6_E1B19K-01        -------------YILDFAAMHLWRAWIRQ---------RGQRILNYWL-
A0A384ZUF2_E1B19K-      -------------YILDFAAMHLWRAWIRQ---------RGQRILNYWL-
A0A384ZUM9_E1B19K-      -------------YILDFAAMHLWRAWIRQ---------RGQRILSYWL-
E1CIR1_E1B19K-01        -------------YILDFAAMHLWRAWIRQ---------RGQRILNYWL-
T1UHQ8_E1B19K-01        -------------YILDFAAMHLWRAWIRQ---------RGQRILNYWL-
T1ULP4_E1B19K-01        -------------YILDFAAMHLWRAWIRQ---------RGQRILNYWL-
A0A291B0H2_E1B19K-      -------------YILDFAAMHLWRAWIRQ---------RGQRILNYWL-
Q7T951_E1B19K-01        -------------YVLDFIATALWRTWKVR---------KMRTILGYWP-
T1UE63_E1B19K-01        -------------YVLDFIATALWRTWKVR---------KMRTILGYWP-
Q7T8D8_E1B19K-01        -------------YVLDFIATALWRTWKVR---------KMRTILGYWP-
Q8B8U7_E1B19K-01        -------------YVLDFIATALWRTWKVR---------KMRTILGYWP-
Q5UW22_E1B19K-01        -------------YVLDFIATALWRTWKVR---------KMRTILGYWP-
W6EIX6_E1B19K-01        -------------YVLDFIATALWRTWKVR---------KMRTILGYWP-
Q3ZL02_E1B19K-01        -------------YVLDFVATALWRTWKVR---------KMRTILGYWP-
A0A1L7NRH1_E1B19K-      -------------YVLDFIATALWRTWKVR---------KMRTILGYWP-
T1UFS4_E1B19K-01        -------------YVLDFVATALWRTWKVR---------KMRTILGYWP-
Q32UI6_E1B19K-01        -------------YVLDFVATALWRTWKVR---------KMRTILGYWP-
C7SRS7_E1B19K-01        -------------YVLDFVATALWRTWKVR---------KMRTILGYWP-
J7H4R9_E1B19K-01        -------------YVLDFVATALWRTWKVR---------KMRTILGYWP-
D2DM83_E1B19K-01        -------------YVLDFVATALWRTWKVR---------KMRTILGYWP-
J7I6W7_E1B19K-01        -------------YVLDFVATALWRTWKVR---------KMRTILGYWP-
T1UJX4_E1B19K-01        -------------YVLDFIATALWRTWKVR---------KMRTILGYWP-
T2CI10_E1B19K-01        -------------YVLDFIAAALWRTWKAR---------RMRTILDYWP-
A0A0K0PX99_E1B19K-      -------------YVLDFIAAALWRTWKAR---------RMRTILDYWP-
A0A0K0PX35_E1B19K-      -------------YVLDFIAAALWRTWKAR---------RMRTILDYWP-
A0A220VZ73_E1B19K-      -------------YVLDFIAAALWRTWKAR---------RMRTILNYWP-
R4HLE1_E1B19K-01        -------------YVLDFIAAALWRTWKAR---------RMRTILDYWP-
R4HMC6_E1B19K-01        -------------YVLDFIAAALWRTWKAR---------RMRTILNYWP-
I1V161_E1B19K-01        -------------YVLDFIAAALWRTWKAR---------RMRTILNYWP-
P03248_E1B19K-02        -------------YVLDFIAAALWRTWKAR---------RMRTILDYWP-
Q6RK98_E1B19K-01        -------------YVLDFIAAALWRTWKAR---------RMRTILDYWP-
J7I6Q4_E1B19K-01        -------------YVLDFIAAALWRTWKAR---------RMRTILDYWP-
J7I6S4_E1B19K-01        -------------YVLDFIAAALWRTWKAR---------RMRTILNYWP-
R4HLJ6_E1B19K-01        -------------YVLDFIAAALWRTWKAR---------RMRTILDYWP-
R4HLA0_E1B19K-01        -------------YVLDFIAAALWRTWKAR---------RMRTILDYWP-
Q2KSL3_E1B19K-01        -------------YVLDFIAAALWRTWKAR---------RMRTILDYWP-
Q2Y0J3_E1B19K-01        -------------YVLDFIAAALWRTWKAR---------RMRTILDYWP-
Q5EY83_E1B19K-01        -------------YVLDFIAAALWRTWKAR---------RMRTILDYWP-
I6LEP5_E1B19K-01        -------------YVLDFIAAALWRTWKAR---------RMRTILDYWP-
I6LES1_E1B19K-01        -------------YVLDFIAAALWRTWKAR---------RMRTILDYWP-
T1UF50_E1B19K-01        -------------YVLDFIAAALWRTWKAR---------RMRTILDYWP-
J7ID56_E1B19K-01        -------------YVLDFIAAALWRTWKAR---------RMRTILDYWP-
A0A0B4SJH1_E1B19K-      -------------YVLDFIAAALWRTWKAR---------RMRTILDYWP-
A0A075IQ70_E1B19K-      -------------YVLDFIAAALWRTWKAR---------RMRTILDYWP-
Q2KS85_E1B19K-01        -------------YVLDFIAAALWRTWKAR---------RMRTILDYWP-
Q3ZKW2_E1B19K-01        -------------YVLDFIAAALWRTWKAR---------SMRTILDYWP-
K7NG43_E1B19K-01        -------------YVLDFIAAALWRTWKAR---------RMRTILDYWP-
Q2KRU2_E1B19K-01        -------------YVLDFIAAALWRTWKAR---------RMRTILDYWP-
T1UIP3_E1B19K-01        -------------YVLDFIAAALWRTWKAR---------RMRTILDYWP-
Q6QPF3_E1B19K-01        -------------YRLDCLAVALWRTWRCQ---------RLNAISGYLP-
Q6QPB7_E1B19K-01        -------------YRLDCLAVALWRTWRCQ---------RLNAISGYLP-
Q6QPI9_E1B19K-01        -------------YRLDCLAVALWRTWRCQ---------RLNAISGYLP-
P10406_E1B19K-01        -------------YQLDFLAVALWRTWKCQ---------RLNAIPATCR-
Q5GFC7_E1B19K-01        -------------YQLDFLAVALWRTWKCQ---------RLNAIPATCR-
A0A2R3WN62_E1B19K-      -------------YQLDFLAVALWRTWKCQ---------RLNAIPATCR-
Q2KSM8_E1B19K-02        -------------YQLDFLAVALWRAWKCQ---------RLNAIPATCR-
Q2KSG6_E1B19K-02        -------------YQLDFLAVALWRAWKCQ---------RLNAI---CR-
A0A2L1F392_E1B19K-      -------------YQLDFLAVALWRAWKCQ---------RLNAI---CR-
Q5GFC8_E1B19K-01        -------------YQLDFLAVALWRTWKCQ---------RLNAISGYLP-
Q6H1D7_E1B19K-01        -------------YQLDFLAVALWRTWKCQ---------RLNAISGYLP-
Q2KSG6_E1B19K-01        -------------YQLDFLAVALWRAWKCQ---------RLNAISGYLP-
Q2KSM8_E1B19K-01        -------------YQLDFLAVALWRAWKCQ---------RLNAISGYLP-
A0A2R3WN16_E1B19K-      -------------YQLDFLAVALWRAWKCQ---------RLNAISGYLP-
A0A2L1F3A2_E1B19K-      -------------YQLDFLAVALWRAWKCQ---------RLNAISGYLP-
G9G841_E1B19K-01        -------------YQLDFLAVALWRTWKSQ---------RLNAISGYLP-
Q8UY91_E1B19K-01        -------------YQLDFLAVALWRTWKCQ---------RLNAISGYLP-
                                                                          

Q71BY5_E1B19K-01        --------------------------------------------------
A0A384ZUF2_E1B19K-      VVGRPKSEMSVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTAS
A0A384ZUM9_E1B19K-      VVGRPKSEMSVKQCVFEKCYLGVSTEGNARVRHCSSLETGCFCLVKGTAS
A0A0M4NHE0_E1B19K-      --------------------------------------------------
H9AAK5_E1B19K-01        --------------------------------------------------
G0ZAH2_E1B19K-01        --------------------------------------------------
A0A1W5PVU4_E1B19K-      --------------------------------------------------
A0A0M3TH18_E1B19K-      --------------------------------------------------
A0A097IW62_E1B19K-      --------------------------------------------------
A0A0A1EUE4_E1B19K-      --------------------------------------------------
A0A2H5AI40_E1B19K-      --------------------------------------------------
A0A2H5AID8_E1B19K-      --------------------------------------------------
A0A2H5AII9_E1B19K-      --------------------------------------------------
A0A2H5AIL0_E1B19K-      --------------------------------------------------
A0A2H5AIN5_E1B19K-      --------------------------------------------------
A0A2H5AIS9_E1B19K-      --------------------------------------------------
A0A2H5AIT6_E1B19K-      --------------------------------------------------
A0A2H5AIU0_E1B19K-      --------------------------------------------------
A0A2H5AIC5_E1B19K-      --------------------------------------------------
D3JIR7_E1B19K-01        --------------------------------------------------
A0A076V686_E1B19K-      --------------------------------------------------
P04492_E1B19K-01        --------------------------------------------------
G1DE13_E1B19K-01        --------------------------------------------------
D0Z5R9_E1B19K-01        --------------------------------------------------
T1UEX7_E1B19K-01        --------------------------------------------------
A0A2H5AI99_E1B19K-      --------------------------------------------------
A0A0M3TH31_E1B19K-      --------------------------------------------------
M9YXY5_E1B19K-01        --------------------------------------------------
M9YVF6_E1B19K-01        --------------------------------------------------
A0MK43_E1B19K-01        --------------------------------------------------
A0A2H5AI21_E1B19K-      --------------------------------------------------
A0A0M5L3Y4_E1B19K-      --------------------------------------------------
Q5C8R2_E1B19K-01        --------------------------------------------------
A0A0A1EUB2_E1B19K-      --------------------------------------------------
A0A0A1EUC8_E1B19K-      --------------------------------------------------
A0A2H5AI04_E1B19K-      --------------------------------------------------
A0A2H5AI72_E1B19K-      --------------------------------------------------
A0A2H5AIL3_E1B19K-      --------------------------------------------------
A0A2H4CJZ0_E1B19K-      --------------------------------------------------
H8PFZ1_E1B19K-01        --------------------------------------------------
F4ZCJ8_E1B19K-01        --------------------------------------------------
A0A1S6ELT2_E1B19K-      --------------------------------------------------
B5SNR1_E1B19K-01        --------------------------------------------------
P10544_E1B19K-01        --------------------------------------------------
W0S1G8_E1B19K-01        --------------------------------------------------
A0A142G3J2_E1B19K-      --------------------------------------------------
P10543_E1B19K-01        --------------------------------------------------
Q71BY5_E1B19K-02        --------------------------------------------------
E1ARN8_E1B19K-01        --------------------------------------------------
A0A2H4PJ75_E1B19K-      --------------------------------------------------
P03246_E1B19K-01        --------------------------------------------------
Q6VGV8_E1B19K-01        --------------------------------------------------
A0A0G2R248_E1B19K-      --------------------------------------------------
Q6WQ37_E1B19K-01        --------------------------------------------------
A0A291P1B2_E1B19K-      --------------------------------------------------
T1UG63_E1B19K-01        --------------------------------------------------
A0A1U9ALK7_E1B19K-      --------------------------------------------------
P03247_E1B19K-01        --------------------------------------------------
J9Z5H0_E1B19K-01        --------------------------------------------------
J7I6T8_E1B19K-01        --------------------------------------------------
J9Z4H6_E1B19K-01        --------------------------------------------------
J9Z4N4_E1B19K-01        --------------------------------------------------
P06501_E1B19K-01        --------------------------------------------------
A0A0M4N3Z1_E1B19K-      --------------------------------------------------
Q8B6X5_E1B19K-01        --------------------------------------------------
H9AAD9_E1B19K-01        --------------------------------------------------
H9AAH3_E1B19K-01        --------------------------------------------------
H9AAA8_E1B19K-01        --------------------------------------------------
M9YVA3_E1B19K-01        --------------------------------------------------
F2WTJ7_E1B19K-01        --------------------------------------------------
F2WTM9_E1B19K-01        --------------------------------------------------
H9AA76_E1B19K-01        --------------------------------------------------
A0A1C8EG46_E1B19K-      --------------------------------------------------
H9AAN8_E1B19K-01        --------------------------------------------------
H9AAS0_E1B19K-01        --------------------------------------------------
H9AAV3_E1B19K-01        --------------------------------------------------
H9AAY5_E1B19K-01        --------------------------------------------------
A0A1L3INW0_E1B19K-      --------------------------------------------------
F6KST6_E1B19K-01        --------------------------------------------------
F2WTG5_E1B19K-01        --------------------------------------------------
Q695T5_E1B19K-01        --------------------------------------------------
H9TER0_E1B19K-01        --------------------------------------------------
A0A0G2UY10_E1B19K-      --------------------------------------------------
X4Y9D2_E1B19K-01        --------------------------------------------------
C5HDR2_E1B19K-01        --------------------------------------------------
M0QVC7_E1B19K-01        --------------------------------------------------
Q4KSL0_E1B19K-01        --------------------------------------------------
A0A1P7YYY5_E1B19K-      --------------------------------------------------
A0A1P8C849_E1B19K-      --------------------------------------------------
B9A5L5_E1B19K-01        --------------------------------------------------
T1UGY3_E1B19K-01        --------------------------------------------------
A0A1P7YWR9_E1B19K-      --------------------------------------------------
A0A1P7YWY2_E1B19K-      --------------------------------------------------
A0A1P7YXN8_E1B19K-      --------------------------------------------------
B9A5A7_E1B19K-01        --------------------------------------------------
T1UG22_E1B19K-01        --------------------------------------------------
H5T740_E1B19K-01        --------------------------------------------------
W8VNG2_E1B19K-01        --------------------------------------------------
F8UFP5_E1B19K-01        --------------------------------------------------
M0QV87_E1B19K-01        --------------------------------------------------
M0QU02_E1B19K-01        --------------------------------------------------
T1UKV6_E1B19K-01        --------------------------------------------------
M0QV47_E1B19K-01        --------------------------------------------------
M0QUW8_E1B19K-01        --------------------------------------------------
E1CIJ0_E1B19K-01        --------------------------------------------------
T1UGU0_E1B19K-01        --------------------------------------------------
M0QVG6_E1B19K-01        --------------------------------------------------
X4YVU5_E1B19K-01        --------------------------------------------------
M0QUS9_E1B19K-01        --------------------------------------------------
G1FBW4_E1B19K-01        --------------------------------------------------
M0QVP5_E1B19K-01        --------------------------------------------------
T1UKQ0_E1B19K-01        --------------------------------------------------
W8CZB0_E1B19K-01        --------------------------------------------------
G1FC01_E1B19K-01        --------------------------------------------------
G3CK71_E1B19K-01        --------------------------------------------------
T1UGT5_E1B19K-01        --------------------------------------------------
T1UK99_E1B19K-01        --------------------------------------------------
M0QTS5_E1B19K-01        --------------------------------------------------
M0QV08_E1B19K-01        --------------------------------------------------
G9JUV5_E1B19K-01        --------------------------------------------------
T1UGX3_E1B19K-01        --------------------------------------------------
T1ULJ8_E1B19K-01        --------------------------------------------------
T1UHG3_E1B19K-01        --------------------------------------------------
A0A1J0MS84_E1B19K-      --------------------------------------------------
A0A097I4T0_E1B19K-      --------------------------------------------------
E9P585_E1B19K-01        --------------------------------------------------
A0A1Y1BXT7_E1B19K-      --------------------------------------------------
E5RWD9_E1B19K-01        --------------------------------------------------
M0QU76_E1B19K-01        --------------------------------------------------
T1UHL7_E1B19K-01        --------------------------------------------------
A0A075TSZ1_E1B19K-      --------------------------------------------------
T1UHH6_E1B19K-01        --------------------------------------------------
T1UKP8_E1B19K-01        --------------------------------------------------
B9A5T7_E1B19K-01        --------------------------------------------------
D3GBW3_E1B19K-01        --------------------------------------------------
M0QUF3_E1B19K-01        --------------------------------------------------
E5RWL1_E1B19K-01        --------------------------------------------------
B6C6W8_E1B19K-01        --------------------------------------------------
M0QU41_E1B19K-01        --------------------------------------------------
F1DT57_E1B19K-01        --------------------------------------------------
B2VQE3_E1B19K-01        --------------------------------------------------
B9A681_E1B19K-01        --------------------------------------------------
A0A1Y1BYF1_E1B19K-      --------------------------------------------------
B6DU90_E1B19K-01        --------------------------------------------------
T1UHZ2_E1B19K-01        --------------------------------------------------
B9A5Q1_E1B19K-01        --------------------------------------------------
M0QUB4_E1B19K-01        --------------------------------------------------
M0QUJ3_E1B19K-01        --------------------------------------------------
M0QUN2_E1B19K-01        --------------------------------------------------
C4P207_E1B19K-01        --------------------------------------------------
E1CIM6_E1B19K-01        --------------------------------------------------
D4N3H6_E1B19K-01        --------------------------------------------------
M0QVK6_E1B19K-01        --------------------------------------------------
M0QVT4_E1B19K-01        --------------------------------------------------
E1AI10_E1B19K-01        --------------------------------------------------
H0PPE7_E1B19K-01        --------------------------------------------------
Q9YL99_E1B19K-01        --------------------------------------------------
K7ZLN6_E1B19K-01        --------------------------------------------------
A0A384ZUF2_E1B19K-      --------------------------------------------------
A0A384ZUM9_E1B19K-      --------------------------------------------------
E1CIR1_E1B19K-01        --------------------------------------------------
T1UHQ8_E1B19K-01        --------------------------------------------------
T1ULP4_E1B19K-01        --------------------------------------------------
A0A291B0H2_E1B19K-      --------------------------------------------------
Q7T951_E1B19K-01        --------------------------------------------------
T1UE63_E1B19K-01        --------------------------------------------------
Q7T8D8_E1B19K-01        --------------------------------------------------
Q8B8U7_E1B19K-01        --------------------------------------------------
Q5UW22_E1B19K-01        --------------------------------------------------
W6EIX6_E1B19K-01        --------------------------------------------------
Q3ZL02_E1B19K-01        --------------------------------------------------
A0A1L7NRH1_E1B19K-      --------------------------------------------------
T1UFS4_E1B19K-01        --------------------------------------------------
Q32UI6_E1B19K-01        --------------------------------------------------
C7SRS7_E1B19K-01        --------------------------------------------------
J7H4R9_E1B19K-01        --------------------------------------------------
D2DM83_E1B19K-01        --------------------------------------------------
J7I6W7_E1B19K-01        --------------------------------------------------
T1UJX4_E1B19K-01        --------------------------------------------------
T2CI10_E1B19K-01        --------------------------------------------------
A0A0K0PX99_E1B19K-      --------------------------------------------------
A0A0K0PX35_E1B19K-      --------------------------------------------------
A0A220VZ73_E1B19K-      --------------------------------------------------
R4HLE1_E1B19K-01        --------------------------------------------------
R4HMC6_E1B19K-01        --------------------------------------------------
I1V161_E1B19K-01        --------------------------------------------------
P03248_E1B19K-02        --------------------------------------------------
Q6RK98_E1B19K-01        --------------------------------------------------
J7I6Q4_E1B19K-01        --------------------------------------------------
J7I6S4_E1B19K-01        --------------------------------------------------
R4HLJ6_E1B19K-01        --------------------------------------------------
R4HLA0_E1B19K-01        --------------------------------------------------
Q2KSL3_E1B19K-01        --------------------------------------------------
Q2Y0J3_E1B19K-01        --------------------------------------------------
Q5EY83_E1B19K-01        --------------------------------------------------
I6LEP5_E1B19K-01        --------------------------------------------------
I6LES1_E1B19K-01        --------------------------------------------------
T1UF50_E1B19K-01        --------------------------------------------------
J7ID56_E1B19K-01        --------------------------------------------------
A0A0B4SJH1_E1B19K-      --------------------------------------------------
A0A075IQ70_E1B19K-      --------------------------------------------------
Q2KS85_E1B19K-01        --------------------------------------------------
Q3ZKW2_E1B19K-01        --------------------------------------------------
K7NG43_E1B19K-01        --------------------------------------------------
Q2KRU2_E1B19K-01        --------------------------------------------------
T1UIP3_E1B19K-01        --------------------------------------------------
Q6QPF3_E1B19K-01        --------------------------------------------------
Q6QPB7_E1B19K-01        --------------------------------------------------
Q6QPI9_E1B19K-01        --------------------------------------------------
P10406_E1B19K-01        --------------------------------------------------
Q5GFC7_E1B19K-01        --------------------------------------------------
A0A2R3WN62_E1B19K-      --------------------------------------------------
Q2KSM8_E1B19K-02        --------------------------------------------------
Q2KSG6_E1B19K-02        --------------------------------------------------
A0A2L1F392_E1B19K-      --------------------------------------------------
Q5GFC8_E1B19K-01        --------------------------------------------------
Q6H1D7_E1B19K-01        --------------------------------------------------
Q2KSG6_E1B19K-01        --------------------------------------------------
Q2KSM8_E1B19K-01        --------------------------------------------------
A0A2R3WN16_E1B19K-      --------------------------------------------------
A0A2L1F3A2_E1B19K-      --------------------------------------------------
G9G841_E1B19K-01        --------------------------------------------------
Q8UY91_E1B19K-01        --------------------------------------------------
                                                                          

Q71BY5_E1B19K-01        --------LLS---------------------------------------
A0A384ZUF2_E1B19K-      LKHNMVKGCTDERMYNMLTCDSGVCHILKNIHVTSHPRKKWPVFENNL--
A0A384ZUM9_E1B19K-      LKHNVVKGCTDERMYNMLTCDSGVCHILKNIHVTSHARKKWPVFENNL--
A0A0M4NHE0_E1B19K-      --------GLPPLGLASVAEERSEESKPEVNPEAQG-----EAKEEAL--
H9AAK5_E1B19K-01        --------GLPPLGLASVAEERSEESKPEVNPEAQG-----EAKEETL--
G0ZAH2_E1B19K-01        --------REVEERLTQVQRELEERERERQQREREQ-----QQQEGEMTT
A0A1W5PVU4_E1B19K-      --------QGPRSLPQRVRRRLGFQTEDQTRL---------LEAEEEP--
A0A0M3TH18_E1B19K-      --------RSLPQ---RVRRRLGFKTEDQTRL---------LEAEEEP--
A0A097IW62_E1B19K-      --------RSLQRLQTSLRRRLGMPTDDRVCL---------LEA-ENP--
A0A0A1EUE4_E1B19K-      --------AQPPRLDRVVEEDE-------------------PDETENL--
A0A2H5AI40_E1B19K-      --------AQPPRLDRVVEENE-------------------PEETENL--
A0A2H5AID8_E1B19K-      --------AQPPRLDRVVEENE-------------------PEETENL--
A0A2H5AII9_E1B19K-      --------AQPPRLDRVVEENE-------------------PEETENL--
A0A2H5AIL0_E1B19K-      --------AQPPRLDRVVEENE-------------------PEETENL--
A0A2H5AIN5_E1B19K-      --------AQPPRLDRVVEENE-------------------PEETENL--
A0A2H5AIS9_E1B19K-      --------AQPPRLDRVVEENE-------------------PEETENL--
A0A2H5AIT6_E1B19K-      --------AQPPRLDRVVEENE-------------------PEETENL--
A0A2H5AIU0_E1B19K-      --------AQPPRLDRVVEENE-------------------PEETENL--
A0A2H5AIC5_E1B19K-      --------AQPPRLDRVVEENE-------------------PEETENL--
D3JIR7_E1B19K-01        --------ARPLT-MPRLPTLQEE-----------------ELEQR----
A0A076V686_E1B19K-      --------ARPLT-MPRLPTLQEE-----------------P-EER----
P04492_E1B19K-01        --------ARPLT-MPPLPTLQEEK----------------EEERN----
G1DE13_E1B19K-01        --------ARPLT-MPPL-----------------------QEEQQ----
D0Z5R9_E1B19K-01        --------ARPLT-MPPL-----------------------QEEQQ----
T1UEX7_E1B19K-01        --------ARPLT-MPPL-----------------------QEEQQ----
A0A2H5AI99_E1B19K-      --------AQPPR-LDRVE--EEDE----------------PVETDNP--
A0A0M3TH31_E1B19K-      --------VQPQRGLERVE--EEEE------------------ENENP--
M9YXY5_E1B19K-01        --------VQPQRGLERVE--EEEE------------------ENENP--
M9YVF6_E1B19K-01        --------VQPQQGLERVE--EEEE--------------------ENP--
A0MK43_E1B19K-01        --------AQPPR-LDRVV--EENE----------------PEETENL--
A0A2H5AI21_E1B19K-      --------AQPPR-LDRVV--EENE----------------PEETENL--
A0A0M5L3Y4_E1B19K-      --------AQPPR-LDRVV--EENE----------------PEETENL--
Q5C8R2_E1B19K-01        --------AQPPR-LDRVV--EENE----------------PEETENL--
A0A0A1EUB2_E1B19K-      --------AQPPR-LGRVE--EEDE----------------PGEMENL--
A0A0A1EUC8_E1B19K-      --------AQPPR-LDRVE--EEDE----------------PGETENL--
A0A2H5AI04_E1B19K-      --------AQPPR-LDRVE--EEDE----------------PGETENL--
A0A2H5AI72_E1B19K-      --------AQPPR-LDRVE--EEDE----------------PGETENL--
A0A2H5AIL3_E1B19K-      --------AQPPR-LDRVE--EEDE----------------PGETENL--
A0A2H4CJZ0_E1B19K-      --------ARPPHGLDPVL--EEPE----------------PEEEENP--
H8PFZ1_E1B19K-01        --------ARPPHGLDPVL--EESE----------------LEEEENP--
F4ZCJ8_E1B19K-01        --------AQPPHGLDPVREEEEEE----------------EEEEENL--
A0A1S6ELT2_E1B19K-      --------AQPPHGLDPVR-EEEEE----------------EEERENL--
B5SNR1_E1B19K-01        --------AQPPHGLDPVR-EEEEE----------------EEEEENL--
P10544_E1B19K-01        --------AQPPHGLDPVR---EEE----------------EEEEENL--
W0S1G8_E1B19K-01        --------AQPPHGLDPVR---EEE----------------EEEEENL--
A0A142G3J2_E1B19K-      --------AQRPHGLDPVQ----EE----------------EEEEENL--
P10543_E1B19K-01        --------AQRPHGLDPVQ----EE----------------EEEEENL--
Q71BY5_E1B19K-02        --------LLSSVRPAIIPTEE-QQQQQQQQEEARRRRRQ-EQSPWNP--
E1ARN8_E1B19K-01        --------LLSSVRPAIIPTEE-QQQQQQQQEEARRRRRQ-EQSPWNP--
A0A2H4PJ75_E1B19K-      --------LLSSVRPAIIPTEE---QQQQQQEEARRRRRQ-EQSPWNP--
P03246_E1B19K-01        --------LLSSVRPAIIPTEE-----QQQQQEEARRRRQ-EQSPWNP--
Q6VGV8_E1B19K-01        --------LLSSVRPAIIPTEE-----QQQQQEEARRRRQ-EQSPWNP--
A0A0G2R248_E1B19K-      --------LLSSVRPAIIPTEE-----QQQQQEEARRRRQ-EQSPWNP--
Q6WQ37_E1B19K-01        --------LLSSVRPAIIPTEE-----QQQQQEEARRRRQ-EQSPWNP--
A0A291P1B2_E1B19K-      --------LLSSVRPAIIPTEE------QQQEEARRRRRQ-EQSPWNP--
T1UG63_E1B19K-01        --------LLSSVRPAIIPTEEQQQQQQQQEEARRRRRRQ-EQSPWNP--
A0A1U9ALK7_E1B19K-      --------LLSSVRPAIIPTEE------QQQEEARRRRRQ-EQSPWNP--
P03247_E1B19K-01        --------LLSSVRPAIIPTEE------QQQEEARRRRRQ-EQSPWNP--
J9Z5H0_E1B19K-01        --------LLSSVRPAIIPTEE------QQQEEARRRRRQ-EQSPWNP--
J7I6T8_E1B19K-01        --------LLSSVRPAIIPTEE--QQQQQQQEEARRRRRQ-EQSPWNP--
J9Z4H6_E1B19K-01        --------LLSSVRPAIIPTEEQQQQQQQQQEEARRRRRQ-EQSPWNP--
J9Z4N4_E1B19K-01        --------LLSSVRPAIIPTEE----QQQQQEEARRRRRQ-EQSPWNP--
P06501_E1B19K-01        ----------PQLGPAAPLARQ--GSQQEE-QQQRQEEEQ-VQE--EM--
A0A0M4N3Z1_E1B19K-      ----------PQLGPVAPLVRQ--GSQQEEQQQQRQEEQQ-VQEEGEM--
Q8B6X5_E1B19K-01        ----------PQLGPVAPLVRQ--GSQQEEQQQQRQEEQQ-VQEEGEM--
H9AAD9_E1B19K-01        ----------PPLGLASVAEER--SEESKPEVNPEAQGEA-KE--ETL--
H9AAH3_E1B19K-01        ----------PPLGLASVAEER--SEESKPEVNPEAQGEA-KE--ETL--
H9AAA8_E1B19K-01        ----------PPLGRASSPEEQ--SPEVKPEVAGQGEEQE-QEQKPAL--
M9YVA3_E1B19K-01        ----------PPLGRASSPEEQ--SPEVKPEVAGQGEEQE-QE--PAL--
F2WTJ7_E1B19K-01        ----------PPLGRASLPEEQ--SPEVKPKVAGQGEEQE-QE--PAL--
F2WTM9_E1B19K-01        ----------PPLGRASLPEEQ--SPEVKPKVAGQGEEQE-QE--PAL--
H9AA76_E1B19K-01        ----------PPLGRASSPEEQ--SPEVKPEVAGQGEEQE-PE--PAL--
A0A1C8EG46_E1B19K-      ----------PPLGRASSPEEQ--LPEVKPEVAGQGEEQE-QK--PAL--
H9AAN8_E1B19K-01        ----------PPLGRASSPEEQ--SPEVKPEVAGQGEEQE-QE--PAL--
H9AAS0_E1B19K-01        ----------PPLGRASSPEEQ--SPEVKPEVAGQGEEQE-QE--PAL--
H9AAV3_E1B19K-01        ----------PPLGRASSPEEQ--SPEVKPEVAGQGEEQE-QE--PAL--
H9AAY5_E1B19K-01        ----------PPLGRASSPEEQ--SPEVKPEVAGQGEEQE-QE--PAL--
A0A1L3INW0_E1B19K-      --------RHPSLIQKTVRAQV--LSRWGALE---------NLAEEDP--
F6KST6_E1B19K-01        --------RHPSLRQHRLQAQA--LLRQEELETILEEEAM-NMEEQNP--
F2WTG5_E1B19K-01        --------RHPSLRQQRLQAQV--LLRREDLEAISEEES--GMEE-NP--
Q695T5_E1B19K-01        --------RHPSLRQQRLQAQV--LLRREDLEAISEEES--GMEEKNP--
H9TER0_E1B19K-01        --------RHPSLRQQRLQAQV--LLRREDLEAISEEES--GMEEKNP--
A0A0G2UY10_E1B19K-      --------LQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
X4Y9D2_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
C5HDR2_E1B19K-01        --------IQP-AVPGLLRLHRQTSMLEEEMR---------QAMDENP--
M0QVC7_E1B19K-01        --------IQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
Q4KSL0_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
A0A1P7YYY5_E1B19K-      --------LQP-AASGLLHLHRQTSMLEEEIR---------EAMDKNP--
A0A1P8C849_E1B19K-      --------LQP-AALGLLHLHRQTSMLEEEMR---------EAMDKNP--
B9A5L5_E1B19K-01        --------LQP-AASGLLHLHRQTSMLEEEMR---------EAMDENP--
T1UGY3_E1B19K-01        --------LQP-AASGLLHLHRQTSMLEEEMR---------EAMDENP--
A0A1P7YWR9_E1B19K-      --------LQP-AASGLLHLHRQTSMLEEEMR---------EAMDKNP--
A0A1P7YWY2_E1B19K-      --------LQP-AASGLLHLHRQTSMLEEEMR---------ESMDKNP--
A0A1P7YXN8_E1B19K-      --------LQP-AASGLLHLHRQTSMLEEEMR---------EAMDKNP--
B9A5A7_E1B19K-01        --------LQP-AASGLLHLHRQTSMLEEEMR---------EAMDKNP--
T1UG22_E1B19K-01        --------LQP-AASGLLHLHRQTSMLEEEMR---------EAMDKNP--
H5T740_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
W8VNG2_E1B19K-01        --------LQP-AAPGLLHLHRQTSMLEEEMR---------EAMDDNP--
F8UFP5_E1B19K-01        --------LQP-AAPGLLHLHRQTSMLEEEMR---------EAMDDNP--
M0QV87_E1B19K-01        --------LQP-AVPGLLRLHRQTSMLEEEMR---------EAMDENP--
M0QU02_E1B19K-01        --------LQP-AAPGLLHLHRQTSMLEEEMR---------EAMDENP--
T1UKV6_E1B19K-01        --------LQP-AVPGLLRLHRQTSMLEEEMR---------EAMDENP--
M0QV47_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------ETMDENP--
M0QUW8_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------EAMDENP--
E1CIJ0_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------EAMDENP--
T1UGU0_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------EAMDENP--
M0QVG6_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------EAMDENP--
X4YVU5_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------EAMDENP--
M0QUS9_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------EAMDENP--
G1FBW4_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------EAMDENP--
M0QVP5_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------EAMDENP--
T1UKQ0_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------EAMDENP--
W8CZB0_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
G1FC01_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
G3CK71_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------QAMYENP--
T1UGT5_E1B19K-01        --------LQP-AVPGLLRLHRQTSMLEEEMR---------EAMDENP--
T1UK99_E1B19K-01        --------LQP-AAPGLLHLHRQTSMLEEEMR---------EAMDENP--
M0QTS5_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
M0QV08_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
G9JUV5_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
T1UGX3_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
T1ULJ8_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
T1UHG3_E1B19K-01        --------LQP-AAPGLLCLHRQTSMLEEEMR---------QAMDENP--
A0A1J0MS84_E1B19K-      --------LQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
A0A097I4T0_E1B19K-      --------IQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
E9P585_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
A0A1Y1BXT7_E1B19K-      --------LQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
E5RWD9_E1B19K-01        --------IQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
M0QU76_E1B19K-01        --------IQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
T1UHL7_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
A0A075TSZ1_E1B19K-      --------LQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
T1UHH6_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
T1UKP8_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
B9A5T7_E1B19K-01        --------IQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
D3GBW3_E1B19K-01        --------IQP-AVPGLLRLHRQTSMLEEEMR---------QAMDENP--
M0QUF3_E1B19K-01        --------IQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
E5RWL1_E1B19K-01        --------IQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
B6C6W8_E1B19K-01        --------IQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
M0QU41_E1B19K-01        --------IQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
F1DT57_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
B2VQE3_E1B19K-01        --------IQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
B9A681_E1B19K-01        --------IQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
A0A1Y1BYF1_E1B19K-      --------IQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
B6DU90_E1B19K-01        --------IQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
T1UHZ2_E1B19K-01        --------IQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
B9A5Q1_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
M0QUB4_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
M0QUJ3_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
M0QUN2_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
C4P207_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
E1CIM6_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
D4N3H6_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
M0QVK6_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
M0QVT4_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
E1AI10_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
H0PPE7_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
Q9YL99_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
K7ZLN6_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
A0A384ZUF2_E1B19K-      --------LQP-AAPVLLRLHRQTSMLEEEMR---------QAMDENP--
A0A384ZUM9_E1B19K-      --------LQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
E1CIR1_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
T1UHQ8_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
T1ULP4_E1B19K-01        --------LQP-AAPGLLRLHRQTSMLEEEMR---------QAMDENP--
A0A291B0H2_E1B19K-      --------LQP-AAPGLLRLHRQTSMLEEEMR---------EAMDENP--
Q7T951_E1B19K-01        --------VQPLGVAGILRHPPVMPAVLEE-----------EQQEDNP--
T1UE63_E1B19K-01        --------VQPLGVAGILRHPPVMPAVLEE-----------EQQEDNP--
Q7T8D8_E1B19K-01        --------VQPLGVAGILRHPPVMPAVLEE-----------EQQEDNP--
Q8B8U7_E1B19K-01        --------VQPLGVAGILRHPPVMPAVLEE-----------EQQEDNP--
Q5UW22_E1B19K-01        --------VQPLGVAGILRHPPVMPAVLEE-----------EQQEDNP--
W6EIX6_E1B19K-01        --------VQPLGVAGILRHPPVMPAVLEE-----------EQQEDNP--
Q3ZL02_E1B19K-01        --------VQPLGVAGILRHPPVMPAVLEE-----------EQQEDNP--
A0A1L7NRH1_E1B19K-      --------VQPLGVAGILRHPPVMPAVLEE-----------EQQEDNP--
T1UFS4_E1B19K-01        --------VQPLGVAGILRHPPVMPAVLEE-----------EQQEDNP--
Q32UI6_E1B19K-01        --------VQPLGVAGILRHPPVMPAVLEE-----------EQQEDNP--
C7SRS7_E1B19K-01        --------VQPLGVAGILRHPPVMPAVLEE-----------EQQEDNP--
J7H4R9_E1B19K-01        --------VQPLGVAGILRHPPVMPAVLEE-----------EQQEDNP--
D2DM83_E1B19K-01        --------VQPLGVAGILRHPPVMPAVLEE-----------EQQEDNP--
J7I6W7_E1B19K-01        --------VQPLGVAGILRHPPVMPAVLEE-----------EQQEDNP--
T1UJX4_E1B19K-01        --------VQPLGVAGILRHPPVMPAVLEE-----------EQQEDNP--
T2CI10_E1B19K-01        --------VQPLGVAGILRHPPTMPAVLEE-----------EHQEDNP--
A0A0K0PX99_E1B19K-      --------VQPLGVAGILRHPPAMPAVLEE-----------EQQEDNP--
A0A0K0PX35_E1B19K-      --------VQPLGVAGILRHPPAMPSVLEE-----------EQQEDNP--
A0A220VZ73_E1B19K-      --------VQPLGVAGILRHPPTMPAVLQE-----------EQQEDNP--
R4HLE1_E1B19K-01        --------VQPLGVAGILRHPPTMPAVLQE-----------EQQEDNP--
R4HMC6_E1B19K-01        --------VQPLGVAGILRHPPTMPAVLQE-----------EQQEDNP--
I1V161_E1B19K-01        --------VQPLGVAGILRHPPTMPAVLQE-----------EQQEDNP--
P03248_E1B19K-02        --------VQPLGVAGILRHPPTMPAVLQE-----------EQQEDNP--
Q6RK98_E1B19K-01        --------VQPLGVAGILRHPPTMPAVLQE-----------EQQEDNP--
J7I6Q4_E1B19K-01        --------VQPLGVAGILRHPPTMPAVLQE-----------EQQEDNP--
J7I6S4_E1B19K-01        --------VQPLGVAGILRHPPTMPAVLQE-----------EQQEDNP--
R4HLJ6_E1B19K-01        --------VQPLGVAGILRHPPTMPAVLQE-----------EQQEDNP--
R4HLA0_E1B19K-01        --------VQPLGVAGILRHPPTMPAVLQE-----------EQQEDNP--
Q2KSL3_E1B19K-01        --------VQPLGVAGILRHPPTMPAVLQE-----------EQQEDNP--
Q2Y0J3_E1B19K-01        --------VQPLGVAGILRHPPTMPAVLQE-----------EQQEDNP--
Q5EY83_E1B19K-01        --------VQPLGVAGILRHPPTMPAVLQE-----------EQQEDNP--
I6LEP5_E1B19K-01        --------VQPLGVAGILRHPPTMPAVLQE-----------EQQEDNP--
I6LES1_E1B19K-01        --------VQPLGVAGILRHPPTMPAVLQE-----------EQQEDNP--
T1UF50_E1B19K-01        --------VQPLGVAGILRHPPTMPAVLQE-----------EQQEDNP--
J7ID56_E1B19K-01        --------VQPLGVAGILRHPPTMPAVLQE-----------EQQEDNP--
A0A0B4SJH1_E1B19K-      --------VQPLGVAGILRHPPAMPAVLEE-----------EQQEDNP--
A0A075IQ70_E1B19K-      --------VQPLGVAGILRHPPAMPAVLEE-----------EQQEDNP--
Q2KS85_E1B19K-01        --------VQPLGVAGILRHPPAMPAVLEE-----------EQQEDNP--
Q3ZKW2_E1B19K-01        --------VQPLGVAGILRHPPTMPAVLEE-----------EQQEDNP--
K7NG43_E1B19K-01        --------VQPLGVAGILRHPPAMPAVLEE-----------EQQEDNP--
Q2KRU2_E1B19K-01        --------VQPLGVAGILRHPPAMPAVLEE-----------EQQEDNP--
T1UIP3_E1B19K-01        --------VQPLGVAGILRHPPAMPAVLEE-----------EQQEDNP--
Q6QPF3_E1B19K-01        --------VQPVDTLRILSLQSPQEHQRRQQPQQEQQQ--EEDREENP--
Q6QPB7_E1B19K-01        --------VQPVDTLRILSLQSPQEHQRRQQPQQEQQQEEEEDREENP--
Q6QPI9_E1B19K-01        --------VQPVDTLRILSLQSPQEHQRRQQPQQEQQQ--EEDREENL--
P10406_E1B19K-01        --------YSR---------------------------------------
Q5GFC7_E1B19K-01        --------YSR---------------------------------------
A0A2R3WN62_E1B19K-      --------YSR---------------------------------------
Q2KSM8_E1B19K-02        --------YSR---------------------------------------
Q2KSG6_E1B19K-02        --------YSR---------------------------------------
A0A2L1F392_E1B19K-      --------YSR---------------------------------------
Q5GFC8_E1B19K-01        --------VQPLDTLRILSL---------------QQQ---EDQEENP--
Q6H1D7_E1B19K-01        --------VQPLDTLRILSL---------------QQQ---EDQEENP--
Q2KSG6_E1B19K-01        --------VQPLDTLRILSLQQISQERQRR----QQQQ---EDQEENP--
Q2KSM8_E1B19K-01        --------VQPLDTLRILSLQQISQERQRR----QQQQ---EDQEENP--
A0A2R3WN16_E1B19K-      --------VQPLDTLRILSLQQISQERQRR----QQQQ---EDQEENP--
A0A2L1F3A2_E1B19K-      --------VQPLDTLRILSLQQISQERQRR----QQQQ---EDQEENP--
G9G841_E1B19K-01        --------VQPLDTLKILNLQESPRARQRRRQQQRQQE---EDQEENP--
Q8UY91_E1B19K-01        --------VQPLDTLRILNLQESPRARQRR--QQQQQE---EDQEENP--
                                                                          

Q71BY5_E1B19K-01        --------------------------------------------------
A0A384ZUF2_E1B19K-      ---LIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDV
A0A384ZUM9_E1B19K-      ---LIKCHMHLGARRGTFQPYQCNFSQTKLLLENDAFSRVNLNGIFDMDV
A0A0M4NHE0_E1B19K-      -------------RSGLDPPVEED--------------------------
H9AAK5_E1B19K-01        -------------RSGLDPPVEEN--------------------------
G0ZAH2_E1B19K-01        SIWRPSMEAEWPPRAGMDPPLEEQWEADHDPEA-----------------
A0A1W5PVU4_E1B19K-      -------------RAGMDPPSET---------------------------
A0A0M3TH18_E1B19K-      -------------RAGTDPPSET---------------------------
A0A097IW62_E1B19K-      -------------RAGMDPPSEN---------------------------
A0A0A1EUE4_E1B19K-      -------------RAGLDPPMED---------------------------
A0A2H5AI40_E1B19K-      -------------RAGLDPPVED---------------------------
A0A2H5AID8_E1B19K-      -------------RAGLDPPVED---------------------------
A0A2H5AII9_E1B19K-      -------------RAGLDPPVED---------------------------
A0A2H5AIL0_E1B19K-      -------------RAGLDPPVED---------------------------
A0A2H5AIN5_E1B19K-      -------------RAGLDPPVED---------------------------
A0A2H5AIS9_E1B19K-      -------------RAGLDPPVED---------------------------
A0A2H5AIT6_E1B19K-      -------------RAGLDPPVED---------------------------
A0A2H5AIU0_E1B19K-      -------------RAGLDPPVED---------------------------
A0A2H5AIC5_E1B19K-      -------------RAGLDPPVED---------------------------
D3JIR7_E1B19K-01        -----------------DPAAEK---------------------------
A0A076V686_E1B19K-      -----------------DPAVEK---------------------------
P04492_E1B19K-01        -----------------PAVVEK---------------------------
G1DE13_E1B19K-01        -----------------NTTTEE---------------------------
D0Z5R9_E1B19K-01        -----------------NTTTEE---------------------------
T1UEX7_E1B19K-01        -----------------NTTTEE---------------------------
A0A2H5AI99_E1B19K-      -------------RAGLDPPVED---------------------------
A0A0M3TH31_E1B19K-      -------------RAGVDPPLE----------------------------
M9YXY5_E1B19K-01        -------------RAGVDPPLE----------------------------
M9YVF6_E1B19K-01        -------------RAGVDPPLE----------------------------
A0MK43_E1B19K-01        -------------RAGLDPPVED---------------------------
A0A2H5AI21_E1B19K-      -------------RAGLDPPVED---------------------------
A0A0M5L3Y4_E1B19K-      -------------RAGLDPPVED---------------------------
Q5C8R2_E1B19K-01        -------------RAGLDPPVED---------------------------
A0A0A1EUB2_E1B19K-      -------------RAGLDPPTED---------------------------
A0A0A1EUC8_E1B19K-      -------------RAGLDPPTED---------------------------
A0A2H5AI04_E1B19K-      -------------RAGLDPPTED---------------------------
A0A2H5AI72_E1B19K-      -------------RAGLDPPTED---------------------------
A0A2H5AIL3_E1B19K-      -------------RAGLDPPTED---------------------------
A0A2H4CJZ0_E1B19K-      -------------RAGLDPSAE----------------------------
H8PFZ1_E1B19K-01        -------------RAGLDPPAE----------------------------
F4ZCJ8_E1B19K-01        -------------RAGLDPQTEL---------------------------
A0A1S6ELT2_E1B19K-      -------------RAGLDPQTEL---------------------------
B5SNR1_E1B19K-01        -------------RAGLDPQTEL---------------------------
P10544_E1B19K-01        -------------RAGLDPQTEL---------------------------
W0S1G8_E1B19K-01        -------------RAGLDPQTEL---------------------------
A0A142G3J2_E1B19K-      -------------RAGLDPSTEL---------------------------
P10543_E1B19K-01        -------------RAGLDPSTEL---------------------------
Q71BY5_E1B19K-02        -------------RAGLDPR-E----------------------------
E1ARN8_E1B19K-01        -------------RAGLDPR-E----------------------------
A0A2H4PJ75_E1B19K-      -------------RAGLDPR-E----------------------------
P03246_E1B19K-01        -------------RAGLDPR-E----------------------------
Q6VGV8_E1B19K-01        -------------RAGLDPR-E----------------------------
A0A0G2R248_E1B19K-      -------------RAGLDPR-E----------------------------
Q6WQ37_E1B19K-01        -------------RAGLDPR-E----------------------------
A0A291P1B2_E1B19K-      -------------RAGLDPR-E----------------------------
T1UG63_E1B19K-01        -------------RAGLDPR-E----------------------------
A0A1U9ALK7_E1B19K-      -------------RAGLDPR-E----------------------------
P03247_E1B19K-01        -------------RAGLDPR-E----------------------------
J9Z5H0_E1B19K-01        -------------RAGLDPR-E----------------------------
J7I6T8_E1B19K-01        -------------RAGLDPR-E----------------------------
J9Z4H6_E1B19K-01        -------------RAGLDPR-E----------------------------
J9Z4N4_E1B19K-01        -------------RAGLDPR-E----------------------------
P06501_E1B19K-01        -------------RSGLDPP-TEN--------------------------
A0A0M4N3Z1_E1B19K-      -------------RSGLDPP-TEN--------------------------
Q8B6X5_E1B19K-01        -------------RSGLDPP-TEN--------------------------
H9AAD9_E1B19K-01        -------------RSGLDPPVEEN--------------------------
H9AAH3_E1B19K-01        -------------RSGLNPPVEEN--------------------------
H9AAA8_E1B19K-01        -------------RSGLDPP-EEN--------------------------
M9YVA3_E1B19K-01        -------------RSGLDPP-EEN--------------------------
F2WTJ7_E1B19K-01        -------------RSGLDPP-EEKED------------------------
F2WTM9_E1B19K-01        -------------RSGLDPP-EEKED------------------------
H9AA76_E1B19K-01        -------------RSGLDPP-EEN--------------------------
A0A1C8EG46_E1B19K-      -------------RSGLGPP-EEN--------------------------
H9AAN8_E1B19K-01        -------------RSGLDPP-EEN--------------------------
H9AAS0_E1B19K-01        -------------RSGLDPP-EEN--------------------------
H9AAV3_E1B19K-01        -------------RSGLDPP-EEN--------------------------
H9AAY5_E1B19K-01        -------------RSGLDPP-EEN--------------------------
A0A1L3INW0_E1B19K-      -------------RAGLDPP-EEEVD------------------------
F6KST6_E1B19K-01        -------------RAGLDPP-VEA--------------------------
F2WTG5_E1B19K-01        -------------RAGLDPP-AEE--------------------------
Q695T5_E1B19K-01        -------------RAGLDPP-AEE--------------------------
H9TER0_E1B19K-01        -------------RAGLDPP-AEE--------------------------
A0A0G2UY10_E1B19K-      -------------RSGLDPPSEEELD------------------------
X4Y9D2_E1B19K-01        -------------RSGLDPPSEEELD------------------------
C5HDR2_E1B19K-01        -------------RSGLDPPSEEELD------------------------
M0QVC7_E1B19K-01        -------------RSGLDPPSEEELD------------------------
Q4KSL0_E1B19K-01        -------------RSGLDPPSEEELD------------------------
A0A1P7YYY5_E1B19K-      -------------RSGLDPPLEEELD------------------------
A0A1P8C849_E1B19K-      -------------RSGLDPPSEEELD------------------------
B9A5L5_E1B19K-01        -------------RSGLDPPSEEELD------------------------
T1UGY3_E1B19K-01        -------------RSGLDPPSEEELD------------------------
A0A1P7YWR9_E1B19K-      -------------RSGLDPPSEEELD------------------------
A0A1P7YWY2_E1B19K-      -------------RSGLDPPSEEELD------------------------
A0A1P7YXN8_E1B19K-      -------------RSGLDPPSEEELD------------------------
B9A5A7_E1B19K-01        -------------RSGLDPPSEEELD------------------------
T1UG22_E1B19K-01        -------------RSGLDPPSEEELD------------------------
H5T740_E1B19K-01        -------------RSGLDPPSEEELD------------------------
W8VNG2_E1B19K-01        -------------RSGLDPPSEEELD------------------------
F8UFP5_E1B19K-01        -------------RSGLDPPSEEELD------------------------
M0QV87_E1B19K-01        -------------RSGLDPPSEEELD------------------------
M0QU02_E1B19K-01        -------------RSGLDPPSEEELD------------------------
T1UKV6_E1B19K-01        -------------RSGLDPPSEEELD------------------------
M0QV47_E1B19K-01        -------------RSGLDPPSEEELD------------------------
M0QUW8_E1B19K-01        -------------RSGLDPPSEEELD------------------------
E1CIJ0_E1B19K-01        -------------RSGLDPPSEEELD------------------------
T1UGU0_E1B19K-01        -------------RSGLDPPSEEELD------------------------
M0QVG6_E1B19K-01        -------------RSGLDPPSEEELD------------------------
X4YVU5_E1B19K-01        -------------RSGLDPPSEEELD------------------------
M0QUS9_E1B19K-01        -------------RSGLDPPSEEELD------------------------
G1FBW4_E1B19K-01        -------------RSGLDPPSEEELD------------------------
M0QVP5_E1B19K-01        -------------RSGLDPPSEEELD------------------------
T1UKQ0_E1B19K-01        -------------RSGLDPPSEEELD------------------------
W8CZB0_E1B19K-01        -------------RSGLDPPSEEELD------------------------
G1FC01_E1B19K-01        -------------RSGLDPPSEEELD------------------------
G3CK71_E1B19K-01        -------------RSGLDPPSEEELD------------------------
T1UGT5_E1B19K-01        -------------RSGLDPPSEEELD------------------------
T1UK99_E1B19K-01        -------------RSGLDPPSEEELD------------------------
M0QTS5_E1B19K-01        -------------RSGLDPPSEEELD------------------------
M0QV08_E1B19K-01        -------------RSGLDPPSEEELD------------------------
G9JUV5_E1B19K-01        -------------RSGLDPPSEEELD------------------------
T1UGX3_E1B19K-01        -------------RSGLDPPSEEELD------------------------
T1ULJ8_E1B19K-01        -------------RSGLDPPSEEELD------------------------
T1UHG3_E1B19K-01        -------------RSGLDPPSEEELD------------------------
A0A1J0MS84_E1B19K-      -------------RSGLDPPSEEELD------------------------
A0A097I4T0_E1B19K-      -------------RSGLDPPPEEELD------------------------
E9P585_E1B19K-01        -------------RSGLDPPLEEELD------------------------
A0A1Y1BXT7_E1B19K-      -------------RSGLDPPSEEELD------------------------
E5RWD9_E1B19K-01        -------------RSGLDPPSEEELD------------------------
M0QU76_E1B19K-01        -------------RSGLDPPSEEELD------------------------
T1UHL7_E1B19K-01        -------------RSGLDPPSEEELD------------------------
A0A075TSZ1_E1B19K-      -------------RSGLDPPSEEELD------------------------
T1UHH6_E1B19K-01        -------------RSGLDPPSEEELD------------------------
T1UKP8_E1B19K-01        -------------RSGLDPPSEEELD------------------------
B9A5T7_E1B19K-01        -------------RSGLDPPSEEELN------------------------
D3GBW3_E1B19K-01        -------------RSGLDPPSEEELD------------------------
M0QUF3_E1B19K-01        -------------RSGLDPPSEEELD------------------------
E5RWL1_E1B19K-01        -------------RSGLDPPSEEELD------------------------
B6C6W8_E1B19K-01        -------------RSGLDPPSEEELN------------------------
M0QU41_E1B19K-01        -------------RSGLDPPSEEELD------------------------
F1DT57_E1B19K-01        -------------RSGLDPPSEEELD------------------------
B2VQE3_E1B19K-01        -------------RSGLDPPSEEELD------------------------
B9A681_E1B19K-01        -------------RSGLDPPSEEELN------------------------
A0A1Y1BYF1_E1B19K-      -------------RSGLDPPSEEELN------------------------
B6DU90_E1B19K-01        -------------RSGLDPPSEEELD------------------------
T1UHZ2_E1B19K-01        -------------RSGLDPPSEEELN------------------------
B9A5Q1_E1B19K-01        -------------RSGLDPPSEEELD------------------------
M0QUB4_E1B19K-01        -------------RSGLDPPSEEELD------------------------
M0QUJ3_E1B19K-01        -------------RSGLDPPSEEELD------------------------
M0QUN2_E1B19K-01        -------------RSGLDPPSEEELD------------------------
C4P207_E1B19K-01        -------------RSGLDPPSEEELD------------------------
E1CIM6_E1B19K-01        -------------RSGLDPPSEEELD------------------------
D4N3H6_E1B19K-01        -------------RSGLDPPSEEELD------------------------
M0QVK6_E1B19K-01        -------------RSGLDPPSEEELD------------------------
M0QVT4_E1B19K-01        -------------RSGLDPPSEEELD------------------------
E1AI10_E1B19K-01        -------------RSGLDPPSEEELD------------------------
H0PPE7_E1B19K-01        -------------RSGLDPPSEEELD------------------------
Q9YL99_E1B19K-01        -------------RSGLDPPSEEELD------------------------
K7ZLN6_E1B19K-01        -------------RSGLDPPSEEELD------------------------
A0A384ZUF2_E1B19K-      -------------RSGLDPPSEEELD------------------------
A0A384ZUM9_E1B19K-      -------------RSGLDPPSEEELD------------------------
E1CIR1_E1B19K-01        -------------RSGLDPPSEEELD------------------------
T1UHQ8_E1B19K-01        -------------RSGLDPPSEEELD------------------------
T1ULP4_E1B19K-01        -------------RSGLDPPSEEELD------------------------
A0A291B0H2_E1B19K-      -------------RSGLDPPSEEELD------------------------
Q7T951_E1B19K-01        -------------RAGLDPPVEEAE-------------------------
T1UE63_E1B19K-01        -------------RAGLDPPVEEAE-------------------------
Q7T8D8_E1B19K-01        -------------RAGLDPPVEEAE-------------------------
Q8B8U7_E1B19K-01        -------------RAGLDPPVEEAE-------------------------
Q5UW22_E1B19K-01        -------------RAGLDPPVEEAE-------------------------
W6EIX6_E1B19K-01        -------------RAGLDPPVEEAE-------------------------
Q3ZL02_E1B19K-01        -------------RAGLDPPVEEAE-------------------------
A0A1L7NRH1_E1B19K-      -------------RAGLDPPVEEAE-------------------------
T1UFS4_E1B19K-01        -------------RAGLDPPVEEAE-------------------------
Q32UI6_E1B19K-01        -------------RAGLDPPVEEAE-------------------------
C7SRS7_E1B19K-01        -------------RAGLDPPVEEAE-------------------------
J7H4R9_E1B19K-01        -------------RAGLDPPVEEAE-------------------------
D2DM83_E1B19K-01        -------------RAGLDPPVEEAE-------------------------
J7I6W7_E1B19K-01        -------------RAGLDPPVEEAE-------------------------
T1UJX4_E1B19K-01        -------------RAGLDPPVEEAE-------------------------
T2CI10_E1B19K-01        -------------RVGLDPPVEEAEE------------------------
A0A0K0PX99_E1B19K-      -------------RAGLDPPVEEAEE------------------------
A0A0K0PX35_E1B19K-      -------------RAGLDPPVEEAEE------------------------
A0A220VZ73_E1B19K-      -------------RAGLDPPVEE---------------------------
R4HLE1_E1B19K-01        -------------RAGLDPPVEE---------------------------
R4HMC6_E1B19K-01        -------------RAGLDPPVEE---------------------------
I1V161_E1B19K-01        -------------RAGLDPPVEE---------------------------
P03248_E1B19K-02        -------------RAGLDPPVEE---------------------------
Q6RK98_E1B19K-01        -------------RAGLDPPVEE---------------------------
J7I6Q4_E1B19K-01        -------------RAGLDPPVEE---------------------------
J7I6S4_E1B19K-01        -------------RAGLDPPVEE---------------------------
R4HLJ6_E1B19K-01        -------------RAGLDPPVEE---------------------------
R4HLA0_E1B19K-01        -------------RAGLDPPVEE---------------------------
Q2KSL3_E1B19K-01        -------------RAGLDPPVEE---------------------------
Q2Y0J3_E1B19K-01        -------------RAGLDPPVEE---------------------------
Q5EY83_E1B19K-01        -------------RAGLDPPVEE---------------------------
I6LEP5_E1B19K-01        -------------RAGLDPPVEE---------------------------
I6LES1_E1B19K-01        -------------RAGLDPPVEE---------------------------
T1UF50_E1B19K-01        -------------RAGLDPPVEE---------------------------
J7ID56_E1B19K-01        -------------RAGLDPPVEE---------------------------
A0A0B4SJH1_E1B19K-      -------------RAGLDPPVEE---------------------------
A0A075IQ70_E1B19K-      -------------RAGLDPPVEE---------------------------
Q2KS85_E1B19K-01        -------------RAGLDPPVEE---------------------------
Q3ZKW2_E1B19K-01        -------------RAGLDPPVEE---------------------------
K7NG43_E1B19K-01        -------------RAGLDPPVEE---------------------------
Q2KRU2_E1B19K-01        -------------RAGLDPPVEE---------------------------
T1UIP3_E1B19K-01        -------------RAGLDPPVEE---------------------------
Q6QPF3_E1B19K-01        -------------RAGLDPPVAEEEE------------------------
Q6QPB7_E1B19K-01        -------------RAGLDPPVAEEEE------------------------
Q6QPI9_E1B19K-01        -------------RAGLDPPVAEEEE------------------------
P10406_E1B19K-01        --------------------------------------------------
Q5GFC7_E1B19K-01        --------------------------------------------------
A0A2R3WN62_E1B19K-      --------------------------------------------------
Q2KSM8_E1B19K-02        --------------------------------------------------
Q2KSG6_E1B19K-02        --------------------------------------------------
A0A2L1F392_E1B19K-      --------------------------------------------------
Q5GFC8_E1B19K-01        -------------RAGLDPPAEE---------------------------
Q6H1D7_E1B19K-01        -------------RAGLDPPAEE---------------------------
Q2KSG6_E1B19K-01        -------------RAGLDPPAEEE--------------------------
Q2KSM8_E1B19K-01        -------------RAGLDPPAEEEE-------------------------
A0A2R3WN16_E1B19K-      -------------RAGLDPPAEEEE-------------------------
A0A2L1F3A2_E1B19K-      -------------RAGLDPPAEEE--------------------------
G9G841_E1B19K-01        -------------RAGLDPPAEEE--------------------------
Q8UY91_E1B19K-01        -------------RAGLDPPAEEEE-------------------------
                                                                          

Q71BY5_E1B19K-01        --------------------------------------------------
A0A384ZUF2_E1B19K-      SVYKILRYDETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVMACTGT
A0A384ZUM9_E1B19K-      SVYKILRYDETKSRVRACECGGRHTRMQPVALDVTEELRPDHLVMACTGT
A0A0M4NHE0_E1B19K-      --------------------------------------------------
H9AAK5_E1B19K-01        --------------------------------------------------
G0ZAH2_E1B19K-01        --------------------------------------------------
A0A1W5PVU4_E1B19K-      --------------------------------------------------
A0A0M3TH18_E1B19K-      --------------------------------------------------
A0A097IW62_E1B19K-      --------------------------------------------------
A0A0A1EUE4_E1B19K-      --------------------------------------------------
A0A2H5AI40_E1B19K-      --------------------------------------------------
A0A2H5AID8_E1B19K-      --------------------------------------------------
A0A2H5AII9_E1B19K-      --------------------------------------------------
A0A2H5AIL0_E1B19K-      --------------------------------------------------
A0A2H5AIN5_E1B19K-      --------------------------------------------------
A0A2H5AIS9_E1B19K-      --------------------------------------------------
A0A2H5AIT6_E1B19K-      --------------------------------------------------
A0A2H5AIU0_E1B19K-      --------------------------------------------------
A0A2H5AIC5_E1B19K-      --------------------------------------------------
D3JIR7_E1B19K-01        --------------------------------------------------
A0A076V686_E1B19K-      --------------------------------------------------
P04492_E1B19K-01        --------------------------------------------------
G1DE13_E1B19K-01        --------------------------------------------------
D0Z5R9_E1B19K-01        --------------------------------------------------
T1UEX7_E1B19K-01        --------------------------------------------------
A0A2H5AI99_E1B19K-      --------------------------------------------------
A0A0M3TH31_E1B19K-      --------------------------------------------------
M9YXY5_E1B19K-01        --------------------------------------------------
M9YVF6_E1B19K-01        --------------------------------------------------
A0MK43_E1B19K-01        --------------------------------------------------
A0A2H5AI21_E1B19K-      --------------------------------------------------
A0A0M5L3Y4_E1B19K-      --------------------------------------------------
Q5C8R2_E1B19K-01        --------------------------------------------------
A0A0A1EUB2_E1B19K-      --------------------------------------------------
A0A0A1EUC8_E1B19K-      --------------------------------------------------
A0A2H5AI04_E1B19K-      --------------------------------------------------
A0A2H5AI72_E1B19K-      --------------------------------------------------
A0A2H5AIL3_E1B19K-      --------------------------------------------------
A0A2H4CJZ0_E1B19K-      --------------------------------------------------
H8PFZ1_E1B19K-01        --------------------------------------------------
F4ZCJ8_E1B19K-01        --------------------------------------------------
A0A1S6ELT2_E1B19K-      --------------------------------------------------
B5SNR1_E1B19K-01        --------------------------------------------------
P10544_E1B19K-01        --------------------------------------------------
W0S1G8_E1B19K-01        --------------------------------------------------
A0A142G3J2_E1B19K-      --------------------------------------------------
P10543_E1B19K-01        --------------------------------------------------
Q71BY5_E1B19K-02        --------------------------------------------------
E1ARN8_E1B19K-01        --------------------------------------------------
A0A2H4PJ75_E1B19K-      --------------------------------------------------
P03246_E1B19K-01        --------------------------------------------------
Q6VGV8_E1B19K-01        --------------------------------------------------
A0A0G2R248_E1B19K-      --------------------------------------------------
Q6WQ37_E1B19K-01        --------------------------------------------------
A0A291P1B2_E1B19K-      --------------------------------------------------
T1UG63_E1B19K-01        --------------------------------------------------
A0A1U9ALK7_E1B19K-      --------------------------------------------------
P03247_E1B19K-01        --------------------------------------------------
J9Z5H0_E1B19K-01        --------------------------------------------------
J7I6T8_E1B19K-01        --------------------------------------------------
J9Z4H6_E1B19K-01        --------------------------------------------------
J9Z4N4_E1B19K-01        --------------------------------------------------
P06501_E1B19K-01        --------------------------------------------------
A0A0M4N3Z1_E1B19K-      --------------------------------------------------
Q8B6X5_E1B19K-01        --------------------------------------------------
H9AAD9_E1B19K-01        --------------------------------------------------
H9AAH3_E1B19K-01        --------------------------------------------------
H9AAA8_E1B19K-01        --------------------------------------------------
M9YVA3_E1B19K-01        --------------------------------------------------
F2WTJ7_E1B19K-01        --------------------------------------------------
F2WTM9_E1B19K-01        --------------------------------------------------
H9AA76_E1B19K-01        --------------------------------------------------
A0A1C8EG46_E1B19K-      --------------------------------------------------
H9AAN8_E1B19K-01        --------------------------------------------------
H9AAS0_E1B19K-01        --------------------------------------------------
H9AAV3_E1B19K-01        --------------------------------------------------
H9AAY5_E1B19K-01        --------------------------------------------------
A0A1L3INW0_E1B19K-      --------------------------------------------------
F6KST6_E1B19K-01        --------------------------------------------------
F2WTG5_E1B19K-01        --------------------------------------------------
Q695T5_E1B19K-01        --------------------------------------------------
H9TER0_E1B19K-01        --------------------------------------------------
A0A0G2UY10_E1B19K-      --------------------------------------------------
X4Y9D2_E1B19K-01        --------------------------------------------------
C5HDR2_E1B19K-01        --------------------------------------------------
M0QVC7_E1B19K-01        --------------------------------------------------
Q4KSL0_E1B19K-01        --------------------------------------------------
A0A1P7YYY5_E1B19K-      --------------------------------------------------
A0A1P8C849_E1B19K-      --------------------------------------------------
B9A5L5_E1B19K-01        --------------------------------------------------
T1UGY3_E1B19K-01        --------------------------------------------------
A0A1P7YWR9_E1B19K-      --------------------------------------------------
A0A1P7YWY2_E1B19K-      --------------------------------------------------
A0A1P7YXN8_E1B19K-      --------------------------------------------------
B9A5A7_E1B19K-01        --------------------------------------------------
T1UG22_E1B19K-01        --------------------------------------------------
H5T740_E1B19K-01        --------------------------------------------------
W8VNG2_E1B19K-01        --------------------------------------------------
F8UFP5_E1B19K-01        --------------------------------------------------
M0QV87_E1B19K-01        --------------------------------------------------
M0QU02_E1B19K-01        --------------------------------------------------
T1UKV6_E1B19K-01        --------------------------------------------------
M0QV47_E1B19K-01        --------------------------------------------------
M0QUW8_E1B19K-01        --------------------------------------------------
E1CIJ0_E1B19K-01        --------------------------------------------------
T1UGU0_E1B19K-01        --------------------------------------------------
M0QVG6_E1B19K-01        --------------------------------------------------
X4YVU5_E1B19K-01        --------------------------------------------------
M0QUS9_E1B19K-01        --------------------------------------------------
G1FBW4_E1B19K-01        --------------------------------------------------
M0QVP5_E1B19K-01        --------------------------------------------------
T1UKQ0_E1B19K-01        --------------------------------------------------
W8CZB0_E1B19K-01        --------------------------------------------------
G1FC01_E1B19K-01        --------------------------------------------------
G3CK71_E1B19K-01        --------------------------------------------------
T1UGT5_E1B19K-01        --------------------------------------------------
T1UK99_E1B19K-01        --------------------------------------------------
M0QTS5_E1B19K-01        --------------------------------------------------
M0QV08_E1B19K-01        --------------------------------------------------
G9JUV5_E1B19K-01        --------------------------------------------------
T1UGX3_E1B19K-01        --------------------------------------------------
T1ULJ8_E1B19K-01        --------------------------------------------------
T1UHG3_E1B19K-01        --------------------------------------------------
A0A1J0MS84_E1B19K-      --------------------------------------------------
A0A097I4T0_E1B19K-      --------------------------------------------------
E9P585_E1B19K-01        --------------------------------------------------
A0A1Y1BXT7_E1B19K-      --------------------------------------------------
E5RWD9_E1B19K-01        --------------------------------------------------
M0QU76_E1B19K-01        --------------------------------------------------
T1UHL7_E1B19K-01        --------------------------------------------------
A0A075TSZ1_E1B19K-      --------------------------------------------------
T1UHH6_E1B19K-01        --------------------------------------------------
T1UKP8_E1B19K-01        --------------------------------------------------
B9A5T7_E1B19K-01        --------------------------------------------------
D3GBW3_E1B19K-01        --------------------------------------------------
M0QUF3_E1B19K-01        --------------------------------------------------
E5RWL1_E1B19K-01        --------------------------------------------------
B6C6W8_E1B19K-01        --------------------------------------------------
M0QU41_E1B19K-01        --------------------------------------------------
F1DT57_E1B19K-01        --------------------------------------------------
B2VQE3_E1B19K-01        --------------------------------------------------
B9A681_E1B19K-01        --------------------------------------------------
A0A1Y1BYF1_E1B19K-      --------------------------------------------------
B6DU90_E1B19K-01        --------------------------------------------------
T1UHZ2_E1B19K-01        --------------------------------------------------
B9A5Q1_E1B19K-01        --------------------------------------------------
M0QUB4_E1B19K-01        --------------------------------------------------
M0QUJ3_E1B19K-01        --------------------------------------------------
M0QUN2_E1B19K-01        --------------------------------------------------
C4P207_E1B19K-01        --------------------------------------------------
E1CIM6_E1B19K-01        --------------------------------------------------
D4N3H6_E1B19K-01        --------------------------------------------------
M0QVK6_E1B19K-01        --------------------------------------------------
M0QVT4_E1B19K-01        --------------------------------------------------
E1AI10_E1B19K-01        --------------------------------------------------
H0PPE7_E1B19K-01        --------------------------------------------------
Q9YL99_E1B19K-01        --------------------------------------------------
K7ZLN6_E1B19K-01        --------------------------------------------------
A0A384ZUF2_E1B19K-      --------------------------------------------------
A0A384ZUM9_E1B19K-      --------------------------------------------------
E1CIR1_E1B19K-01        --------------------------------------------------
T1UHQ8_E1B19K-01        --------------------------------------------------
T1ULP4_E1B19K-01        --------------------------------------------------
A0A291B0H2_E1B19K-      --------------------------------------------------
Q7T951_E1B19K-01        --------------------------------------------------
T1UE63_E1B19K-01        --------------------------------------------------
Q7T8D8_E1B19K-01        --------------------------------------------------
Q8B8U7_E1B19K-01        --------------------------------------------------
Q5UW22_E1B19K-01        --------------------------------------------------
W6EIX6_E1B19K-01        --------------------------------------------------
Q3ZL02_E1B19K-01        --------------------------------------------------
A0A1L7NRH1_E1B19K-      --------------------------------------------------
T1UFS4_E1B19K-01        --------------------------------------------------
Q32UI6_E1B19K-01        --------------------------------------------------
C7SRS7_E1B19K-01        --------------------------------------------------
J7H4R9_E1B19K-01        --------------------------------------------------
D2DM83_E1B19K-01        --------------------------------------------------
J7I6W7_E1B19K-01        --------------------------------------------------
T1UJX4_E1B19K-01        --------------------------------------------------
T2CI10_E1B19K-01        --------------------------------------------------
A0A0K0PX99_E1B19K-      --------------------------------------------------
A0A0K0PX35_E1B19K-      --------------------------------------------------
A0A220VZ73_E1B19K-      --------------------------------------------------
R4HLE1_E1B19K-01        --------------------------------------------------
R4HMC6_E1B19K-01        --------------------------------------------------
I1V161_E1B19K-01        --------------------------------------------------
P03248_E1B19K-02        --------------------------------------------------
Q6RK98_E1B19K-01        --------------------------------------------------
J7I6Q4_E1B19K-01        --------------------------------------------------
J7I6S4_E1B19K-01        --------------------------------------------------
R4HLJ6_E1B19K-01        --------------------------------------------------
R4HLA0_E1B19K-01        --------------------------------------------------
Q2KSL3_E1B19K-01        --------------------------------------------------
Q2Y0J3_E1B19K-01        --------------------------------------------------
Q5EY83_E1B19K-01        --------------------------------------------------
I6LEP5_E1B19K-01        --------------------------------------------------
I6LES1_E1B19K-01        --------------------------------------------------
T1UF50_E1B19K-01        --------------------------------------------------
J7ID56_E1B19K-01        --------------------------------------------------
A0A0B4SJH1_E1B19K-      --------------------------------------------------
A0A075IQ70_E1B19K-      --------------------------------------------------
Q2KS85_E1B19K-01        --------------------------------------------------
Q3ZKW2_E1B19K-01        --------------------------------------------------
K7NG43_E1B19K-01        --------------------------------------------------
Q2KRU2_E1B19K-01        --------------------------------------------------
T1UIP3_E1B19K-01        --------------------------------------------------
Q6QPF3_E1B19K-01        --------------------------------------------------
Q6QPB7_E1B19K-01        --------------------------------------------------
Q6QPI9_E1B19K-01        --------------------------------------------------
P10406_E1B19K-01        --------------------------------------------------
Q5GFC7_E1B19K-01        --------------------------------------------------
A0A2R3WN62_E1B19K-      --------------------------------------------------
Q2KSM8_E1B19K-02        --------------------------------------------------
Q2KSG6_E1B19K-02        --------------------------------------------------
A0A2L1F392_E1B19K-      --------------------------------------------------
Q5GFC8_E1B19K-01        --------------------------------------------------
Q6H1D7_E1B19K-01        --------------------------------------------------
Q2KSG6_E1B19K-01        --------------------------------------------------
Q2KSM8_E1B19K-01        --------------------------------------------------
A0A2R3WN16_E1B19K-      --------------------------------------------------
A0A2L1F3A2_E1B19K-      --------------------------------------------------
G9G841_E1B19K-01        --------------------------------------------------
Q8UY91_E1B19K-01        --------------------------------------------------
                                                                          

Q71BY5_E1B19K-01        ----------
A0A384ZUF2_E1B19K-      EFSSSGEDTD
A0A384ZUM9_E1B19K-      EFSSSGEDTD
A0A0M4NHE0_E1B19K-      ----------
H9AAK5_E1B19K-01        ----------
G0ZAH2_E1B19K-01        ----------
A0A1W5PVU4_E1B19K-      ----------
A0A0M3TH18_E1B19K-      ----------
A0A097IW62_E1B19K-      ----------
A0A0A1EUE4_E1B19K-      ----------
A0A2H5AI40_E1B19K-      ----------
A0A2H5AID8_E1B19K-      ----------
A0A2H5AII9_E1B19K-      ----------
A0A2H5AIL0_E1B19K-      ----------
A0A2H5AIN5_E1B19K-      ----------
A0A2H5AIS9_E1B19K-      ----------
A0A2H5AIT6_E1B19K-      ----------
A0A2H5AIU0_E1B19K-      ----------
A0A2H5AIC5_E1B19K-      ----------
D3JIR7_E1B19K-01        ----------
A0A076V686_E1B19K-      ----------
P04492_E1B19K-01        ----------
G1DE13_E1B19K-01        ----------
D0Z5R9_E1B19K-01        ----------
T1UEX7_E1B19K-01        ----------
A0A2H5AI99_E1B19K-      ----------
A0A0M3TH31_E1B19K-      ----------
M9YXY5_E1B19K-01        ----------
M9YVF6_E1B19K-01        ----------
A0MK43_E1B19K-01        ----------
A0A2H5AI21_E1B19K-      ----------
A0A0M5L3Y4_E1B19K-      ----------
Q5C8R2_E1B19K-01        ----------
A0A0A1EUB2_E1B19K-      ----------
A0A0A1EUC8_E1B19K-      ----------
A0A2H5AI04_E1B19K-      ----------
A0A2H5AI72_E1B19K-      ----------
A0A2H5AIL3_E1B19K-      ----------
A0A2H4CJZ0_E1B19K-      ----------
H8PFZ1_E1B19K-01        ----------
F4ZCJ8_E1B19K-01        ----------
A0A1S6ELT2_E1B19K-      ----------
B5SNR1_E1B19K-01        ----------
P10544_E1B19K-01        ----------
W0S1G8_E1B19K-01        ----------
A0A142G3J2_E1B19K-      ----------
P10543_E1B19K-01        ----------
Q71BY5_E1B19K-02        ----------
E1ARN8_E1B19K-01        ----------
A0A2H4PJ75_E1B19K-      ----------
P03246_E1B19K-01        ----------
Q6VGV8_E1B19K-01        ----------
A0A0G2R248_E1B19K-      ----------
Q6WQ37_E1B19K-01        ----------
A0A291P1B2_E1B19K-      ----------
T1UG63_E1B19K-01        ----------
A0A1U9ALK7_E1B19K-      ----------
P03247_E1B19K-01        ----------
J9Z5H0_E1B19K-01        ----------
J7I6T8_E1B19K-01        ----------
J9Z4H6_E1B19K-01        ----------
J9Z4N4_E1B19K-01        ----------
P06501_E1B19K-01        ----------
A0A0M4N3Z1_E1B19K-      ----------
Q8B6X5_E1B19K-01        ----------
H9AAD9_E1B19K-01        ----------
H9AAH3_E1B19K-01        ----------
H9AAA8_E1B19K-01        ----------
M9YVA3_E1B19K-01        ----------
F2WTJ7_E1B19K-01        ----------
F2WTM9_E1B19K-01        ----------
H9AA76_E1B19K-01        ----------
A0A1C8EG46_E1B19K-      ----------
H9AAN8_E1B19K-01        ----------
H9AAS0_E1B19K-01        ----------
H9AAV3_E1B19K-01        ----------
H9AAY5_E1B19K-01        ----------
A0A1L3INW0_E1B19K-      ----------
F6KST6_E1B19K-01        ----------
F2WTG5_E1B19K-01        ----------
Q695T5_E1B19K-01        ----------
H9TER0_E1B19K-01        ----------
A0A0G2UY10_E1B19K-      ----------
X4Y9D2_E1B19K-01        ----------
C5HDR2_E1B19K-01        ----------
M0QVC7_E1B19K-01        ----------
Q4KSL0_E1B19K-01        ----------
A0A1P7YYY5_E1B19K-      ----------
A0A1P8C849_E1B19K-      ----------
B9A5L5_E1B19K-01        ----------
T1UGY3_E1B19K-01        ----------
A0A1P7YWR9_E1B19K-      ----------
A0A1P7YWY2_E1B19K-      ----------
A0A1P7YXN8_E1B19K-      ----------
B9A5A7_E1B19K-01        ----------
T1UG22_E1B19K-01        ----------
H5T740_E1B19K-01        ----------
W8VNG2_E1B19K-01        ----------
F8UFP5_E1B19K-01        ----------
M0QV87_E1B19K-01        ----------
M0QU02_E1B19K-01        ----------
T1UKV6_E1B19K-01        ----------
M0QV47_E1B19K-01        ----------
M0QUW8_E1B19K-01        ----------
E1CIJ0_E1B19K-01        ----------
T1UGU0_E1B19K-01        ----------
M0QVG6_E1B19K-01        ----------
X4YVU5_E1B19K-01        ----------
M0QUS9_E1B19K-01        ----------
G1FBW4_E1B19K-01        ----------
M0QVP5_E1B19K-01        ----------
T1UKQ0_E1B19K-01        ----------
W8CZB0_E1B19K-01        ----------
G1FC01_E1B19K-01        ----------
G3CK71_E1B19K-01        ----------
T1UGT5_E1B19K-01        ----------
T1UK99_E1B19K-01        ----------
M0QTS5_E1B19K-01        ----------
M0QV08_E1B19K-01        ----------
G9JUV5_E1B19K-01        ----------
T1UGX3_E1B19K-01        ----------
T1ULJ8_E1B19K-01        ----------
T1UHG3_E1B19K-01        ----------
A0A1J0MS84_E1B19K-      ----------
A0A097I4T0_E1B19K-      ----------
E9P585_E1B19K-01        ----------
A0A1Y1BXT7_E1B19K-      ----------
E5RWD9_E1B19K-01        ----------
M0QU76_E1B19K-01        ----------
T1UHL7_E1B19K-01        ----------
A0A075TSZ1_E1B19K-      ----------
T1UHH6_E1B19K-01        ----------
T1UKP8_E1B19K-01        ----------
B9A5T7_E1B19K-01        ----------
D3GBW3_E1B19K-01        ----------
M0QUF3_E1B19K-01        ----------
E5RWL1_E1B19K-01        ----------
B6C6W8_E1B19K-01        ----------
M0QU41_E1B19K-01        ----------
F1DT57_E1B19K-01        ----------
B2VQE3_E1B19K-01        ----------
B9A681_E1B19K-01        ----------
A0A1Y1BYF1_E1B19K-      ----------
B6DU90_E1B19K-01        ----------
T1UHZ2_E1B19K-01        ----------
B9A5Q1_E1B19K-01        ----------
M0QUB4_E1B19K-01        ----------
M0QUJ3_E1B19K-01        ----------
M0QUN2_E1B19K-01        ----------
C4P207_E1B19K-01        ----------
E1CIM6_E1B19K-01        ----------
D4N3H6_E1B19K-01        ----------
M0QVK6_E1B19K-01        ----------
M0QVT4_E1B19K-01        ----------
E1AI10_E1B19K-01        ----------
H0PPE7_E1B19K-01        ----------
Q9YL99_E1B19K-01        ----------
K7ZLN6_E1B19K-01        ----------
A0A384ZUF2_E1B19K-      ----------
A0A384ZUM9_E1B19K-      ----------
E1CIR1_E1B19K-01        ----------
T1UHQ8_E1B19K-01        ----------
T1ULP4_E1B19K-01        ----------
A0A291B0H2_E1B19K-      ----------
Q7T951_E1B19K-01        ----------
T1UE63_E1B19K-01        ----------
Q7T8D8_E1B19K-01        ----------
Q8B8U7_E1B19K-01        ----------
Q5UW22_E1B19K-01        ----------
W6EIX6_E1B19K-01        ----------
Q3ZL02_E1B19K-01        ----------
A0A1L7NRH1_E1B19K-      ----------
T1UFS4_E1B19K-01        ----------
Q32UI6_E1B19K-01        ----------
C7SRS7_E1B19K-01        ----------
J7H4R9_E1B19K-01        ----------
D2DM83_E1B19K-01        ----------
J7I6W7_E1B19K-01        ----------
T1UJX4_E1B19K-01        ----------
T2CI10_E1B19K-01        ----------
A0A0K0PX99_E1B19K-      ----------
A0A0K0PX35_E1B19K-      ----------
A0A220VZ73_E1B19K-      ----------
R4HLE1_E1B19K-01        ----------
R4HMC6_E1B19K-01        ----------
I1V161_E1B19K-01        ----------
P03248_E1B19K-02        ----------
Q6RK98_E1B19K-01        ----------
J7I6Q4_E1B19K-01        ----------
J7I6S4_E1B19K-01        ----------
R4HLJ6_E1B19K-01        ----------
R4HLA0_E1B19K-01        ----------
Q2KSL3_E1B19K-01        ----------
Q2Y0J3_E1B19K-01        ----------
Q5EY83_E1B19K-01        ----------
I6LEP5_E1B19K-01        ----------
I6LES1_E1B19K-01        ----------
T1UF50_E1B19K-01        ----------
J7ID56_E1B19K-01        ----------
A0A0B4SJH1_E1B19K-      ----------
A0A075IQ70_E1B19K-      ----------
Q2KS85_E1B19K-01        ----------
Q3ZKW2_E1B19K-01        ----------
K7NG43_E1B19K-01        ----------
Q2KRU2_E1B19K-01        ----------
T1UIP3_E1B19K-01        ----------
Q6QPF3_E1B19K-01        ----------
Q6QPB7_E1B19K-01        ----------
Q6QPI9_E1B19K-01        ----------
P10406_E1B19K-01        ----------
Q5GFC7_E1B19K-01        ----------
A0A2R3WN62_E1B19K-      ----------
Q2KSM8_E1B19K-02        ----------
Q2KSG6_E1B19K-02        ----------
A0A2L1F392_E1B19K-      ----------
Q5GFC8_E1B19K-01        ----------
Q6H1D7_E1B19K-01        ----------
Q2KSG6_E1B19K-01        ----------
Q2KSM8_E1B19K-01        ----------
A0A2R3WN16_E1B19K-      ----------
A0A2L1F3A2_E1B19K-      ----------
G9G841_E1B19K-01        ----------
Q8UY91_E1B19K-01        ----------
                                  

© 1998-2019