Dataset for protein adenoviridae of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

219 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q71BY5_E1B19K-01        -----------------------------------------------MRH
A0A0M4NHE0_E1B19K-      MINCCELWLFIQRVLPGRYKGSGFQARGIYPLAAFMDLRAELQTFESTRR
H9AAK5_E1B19K-01        MINGCELWLFIQRGLPGRYKGSGFQARGIYPLAAFMDLRAELQTFESTRR
G0ZAH2_E1B19K-01        -----------------------------------MDLLKFLEDFENCRQ
A0A1W5PVU4_E1B19K-      ------------------------MMKRPVAAEVQMELDRLLENYNSLRR
A0A0M3TH18_E1B19K-      -------------------------MKRPVAAEVQMELDRLLENYNSLRR
A0A097IW62_E1B19K-      -----------------------------------MDLDRVLENYNSLRK
A0A0A1EUE4_E1B19K-      --------------------------MGSESTSALMDLLGNLREFDVVRR
A0A2H5AI40_E1B19K-      --------------------------MGSESTAALMDLLGNLREFDVVRR
A0A2H5AID8_E1B19K-      --------------------------MGSESTAALMDLLGNLREFDVVRR
A0A2H5AII9_E1B19K-      --------------------------MGSESTAALMDLLGNLREFDVVRR
A0A2H5AIL0_E1B19K-      --------------------------MGSESTAALMDLLGNLREFDVVRR
A0A2H5AIN5_E1B19K-      --------------------------MGSESTAALMDLLGNLREFDVVRR
A0A2H5AIS9_E1B19K-      --------------------------MGSESTAALMDLLGNLREFDVVRR
A0A2H5AIT6_E1B19K-      --------------------------MGSESTAALMDLLGNLREFDVVRR
A0A2H5AIU0_E1B19K-      --------------------------MGSESTAALMDLLGNLREFDVVRR
A0A2H5AIC5_E1B19K-      --------------------------MGSESTAALMDLLGNLREFDVVRR
D3JIR7_E1B19K-01        -----------------------------------MELEAVLQSYQGVRQ
A0A076V686_E1B19K-      -----------------------------------MELEAVLQSYQSIRQ
P04492_E1B19K-01        -----------------------------------MELETVLQSFQSVRQ
G1DE13_E1B19K-01        -----------------------------------MELEAVLQSFQSVRQ
D0Z5R9_E1B19K-01        -----------------------------------MELEAVLQSFQSVRQ
T1UEX7_E1B19K-01        -----------------------------------MELEAVLQSFQSVRQ
A0A2H5AI99_E1B19K-      -----------------------------------MDLLKELRDFDVVRQ
A0A0M3TH31_E1B19K-      -----------------------------------MDLLRLLSDYEVLRK
M9YXY5_E1B19K-01        -----------------------------------MDLLRLLSDYEVLRK
M9YVF6_E1B19K-01        -----------------------------------MDLLRLLSDYEVLRK
A0MK43_E1B19K-01        -----------------------------------MDLLGNLREFDVVRR
A0A2H5AI21_E1B19K-      -----------------------------------MDLLGDLREFGVVRR
A0A0M5L3Y4_E1B19K-      -----------------------------------MDLLGDLREFGVVRR
Q5C8R2_E1B19K-01        -----------------------------------MDLLGDLREFGVVRR
A0A0A1EUB2_E1B19K-      -----------------------------------MDLLGDLREFGVVRR
A0A0A1EUC8_E1B19K-      -----------------------------------MDLLGDLREFGVVRR
A0A2H5AI04_E1B19K-      -----------------------------------MDLLGDLREFGVVRR
A0A2H5AI72_E1B19K-      -----------------------------------MDLLGDLREFGVVRR
A0A2H5AIL3_E1B19K-      -----------------------------------MDLLGDLREFGVVRR
A0A2H4CJZ0_E1B19K-      -----------------------------------MEFWSELQNYQSLRH
H8PFZ1_E1B19K-01        -----------------------------------MEYWSELQNYQSLRR
F4ZCJ8_E1B19K-01        -----------------------------------MEFWSELQSYQSLRR
A0A1S6ELT2_E1B19K-      -----------------------------------MEFWSELQSYQSLRR
B5SNR1_E1B19K-01        -----------------------------------MEFWSELQSYQSLRR
P10544_E1B19K-01        -----------------------------------MEFWSELQSYQSLRR
W0S1G8_E1B19K-01        -----------------------------------MEFWSELQSYQSLRR
A0A142G3J2_E1B19K-      -----------------------------------MELWSELQSYQNLRR
P10543_E1B19K-01        -----------------------------------MELWSELQSYQNLRR
Q71BY5_E1B19K-02        -----------------------------------MEAWECLEDFSAVRN
E1ARN8_E1B19K-01        -----------------------------------MEAWECLEDFSAVRN
A0A2H4PJ75_E1B19K-      -----------------------------------MEAWECLEDFSAVRN
P03246_E1B19K-01        -----------------------------------MEAWECLEDFSAVRN
Q6VGV8_E1B19K-01        -----------------------------------MEAWECLEDFSAVRN
A0A0G2R248_E1B19K-      -----------------------------------MEAWECLEDFSAVRN
Q6WQ37_E1B19K-01        -----------------------------------MEAWECLEDFSAVRN
A0A291P1B2_E1B19K-      -----------------------------------METWECLEDFSAVRN
T1UG63_E1B19K-01        -----------------------------------MEAWECLEDFSAVRN
A0A1U9ALK7_E1B19K-      -----------------------------------MEAWECLEDFSAVRN
P03247_E1B19K-01        -----------------------------------MEAWECLEDFSAVRN
J9Z5H0_E1B19K-01        -----------------------------------MEAWECLEDFSAVRN
J7I6T8_E1B19K-01        -----------------------------------MEAWECLEDFSAVRN
J9Z4H6_E1B19K-01        -----------------------------------MEAWECLEDFSAVRN
J9Z4N4_E1B19K-01        -----------------------------------MEAWECLEDFSAVRN
P06501_E1B19K-01        -----------------------------------MDLRTALQTFESTRR
A0A0M4N3Z1_E1B19K-      -----------------------------------MDLRTALQTFESTRR
Q8B6X5_E1B19K-01        -----------------------------------MDLRTALQTFESTRR
H9AAD9_E1B19K-01        -----------------------------------MDLRAELQTFESTRR
H9AAH3_E1B19K-01        -----------------------------------MDLRAELQTFESTRR
H9AAA8_E1B19K-01        -----------------------------------MDLRVELQTFESTRC
M9YVA3_E1B19K-01        -----------------------------------MDLRVELQTFESTRC
F2WTJ7_E1B19K-01        -----MINDVNFVCLFKGDYLGGIKGAAVGLGHFTMDLRVELQTFESTRC
F2WTM9_E1B19K-01        -----MINDVNFVCLFKGDYLGGIKGAAVGLGHFTMNLRVELQTFESTRC
H9AA76_E1B19K-01        -----MINDVNFVCLFKGDYLGGIKGVVVRLGHFTMDLRVELQTFESTRC
A0A1C8EG46_E1B19K-      -----MINDVNFVCLFKGDYLGGIKGAVVRLGHFTMDLRVELQTFESTRC
H9AAN8_E1B19K-01        -----MINDVNFVCLFKGDYLGGIKGAVVRLGHFTMDLRVELQTFESTRC
H9AAS0_E1B19K-01        -----MINDVNFVCLFKGDYLGGIKGAVVRLGHFTMDLRVELQTFESTRC
H9AAV3_E1B19K-01        -----MINDVNFVCLFKGDYLGGIKGAVVRLGHFTMDLRVELQTFESTRC
H9AAY5_E1B19K-01        -----MINDVNFVCLFKGDYLGGIKGAVVRLGHFTMDLRVELQTFESTRC
A0A1L3INW0_E1B19K-      -----------------------------------MDLYKSLEDRSTLRQ
F6KST6_E1B19K-01        -----------------------------------MDLYESLENLGSLRR
F2WTG5_E1B19K-01        -----------------------------------MDLYESLENLSSLRR
Q695T5_E1B19K-01        -----------------------------------MDLYESLENLSSLRR
H9TER0_E1B19K-01        -----------------------------------MDLYESLENLSSLRR
A0A0G2UY10_E1B19K-      ---------MTHGRGLVLYKWQHLGTWAQTFREFLMDVWTILADFSKTRR
X4Y9D2_E1B19K-01        ---------MTHGRGLVLYKWQHLGTRAQTFREFLMDVWTILADFSKTRR
C5HDR2_E1B19K-01        ---------MTHGRGLVLYKWQHLGTWAQTFREFLMDVWTILADFSKTRR
M0QVC7_E1B19K-01        ---------MTHGRGLVLYKWQHLGTGAQTFRKFLMDVWTILADFSKTRR
Q4KSL0_E1B19K-01        ---------MTHGRGLVLYKWQHLGTGAQTFREFLMDVWTILADFSKTRR
A0A1P7YYY5_E1B19K-      -----------------------------------MDVWSILGEFNKTRR
A0A1P8C849_E1B19K-      -----------------------------------MDVWSILGEFNKTRR
B9A5L5_E1B19K-01        -----------------------------------MDVWSILGEFNKTRR
T1UGY3_E1B19K-01        -----------------------------------MDVWSILGEFNKTRR
A0A1P7YWR9_E1B19K-      -----------------------------------MDVWSILGEFNKTRR
A0A1P7YWY2_E1B19K-      -----------------------------------MDVWSILGEFNKTRR
A0A1P7YXN8_E1B19K-      -----------------------------------MDVWSILGEFNKTRR
B9A5A7_E1B19K-01        -----------------------------------MDVWSILGEFNKTRR
T1UG22_E1B19K-01        -----------------------------------MDVWSILGEFNKTRR
H5T740_E1B19K-01        -----------------------------------MEVWTILADFNKTRR
W8VNG2_E1B19K-01        -----------------------------------MEVWTILGDFNKTRR
F8UFP5_E1B19K-01        -----------------------------------MEVWTILADFNKTRR
M0QV87_E1B19K-01        -----------------------------------MDVWTILGDFVKTRR
M0QU02_E1B19K-01        -----------------------------------MDVWTILADFNKTRR
T1UKV6_E1B19K-01        -----------------------------------MDVWTILGDFNKTRR
M0QV47_E1B19K-01        -----------------------------------MEVWTILADFNKTRR
M0QUW8_E1B19K-01        -----------------------------------MEVWTILADFNKTRR
E1CIJ0_E1B19K-01        -----------------------------------MEVWTILADFNKTRR
T1UGU0_E1B19K-01        -----------------------------------MEVWTILADFNKTRR
M0QVG6_E1B19K-01        -----------------------------------MEVWTILADFSKTRR
X4YVU5_E1B19K-01        -----------------------------------MEVWTILADFSKTRR
M0QUS9_E1B19K-01        -----------------------------------MEVWTILADFNKTRR
G1FBW4_E1B19K-01        -----------------------------------MEVWTILADFNKTRR
M0QVP5_E1B19K-01        -----------------------------------MDVWTILADFNKTRR
T1UKQ0_E1B19K-01        -----------------------------------MDVWTILADFNKTRR
W8CZB0_E1B19K-01        -----------------------------------MEVWTILGDFNKTRR
G1FC01_E1B19K-01        -----------------------------------MEVWTILGDFNKTRR
G3CK71_E1B19K-01        -----------------------------------MEVWTILGDFNKTRR
T1UGT5_E1B19K-01        -----------------------------------MEVWTILADFNKTRR
T1UK99_E1B19K-01        -----------------------------------MEVWTILGDFNKTRR
M0QTS5_E1B19K-01        -----------------------------------MEVWTILADFSKTRR
M0QV08_E1B19K-01        -----------------------------------MEVWTILADFSKTRR
G9JUV5_E1B19K-01        -----------------------------------MEVWTILADFSKTRR
T1UGX3_E1B19K-01        -----------------------------------MDVWTILADFSQTRR
T1ULJ8_E1B19K-01        -----------------------------------MDVWTILADFSKTRR
T1UHG3_E1B19K-01        -----------------------------------MDVWTILADFSKTRR
A0A1J0MS84_E1B19K-      -----------------------------------MDVWTILADFSKTRR
A0A097I4T0_E1B19K-      -----------------------------------MDVWTILADFSKTRR
E9P585_E1B19K-01        -----------------------------------MDVWTILADFSKTRR
A0A1Y1BXT7_E1B19K-      -----------------------------------MDVWTILADFSKTRR
E5RWD9_E1B19K-01        -----------------------------------MDVWTILADFSKTRR
M0QU76_E1B19K-01        -----------------------------------MDVWTILADFSKTRR
T1UHL7_E1B19K-01        -----------------------------------MDVWTILADFSKTRR
A0A075TSZ1_E1B19K-      -----------------------------------MDVWTILADFSKTRR
T1UHH6_E1B19K-01        -----------------------------------MDVWTILADFSKTRR
T1UKP8_E1B19K-01        -----------------------------------MDVWTILADFSKTRR
B9A5T7_E1B19K-01        -----------------------------------MDVWTILADFSKTRR
D3GBW3_E1B19K-01        -----------------------------------MDVWTILADFSKTRR
M0QUF3_E1B19K-01        -----------------------------------MDVWTILADFSKTRR
E5RWL1_E1B19K-01        -----------------------------------MDVWTILADFSKTRR
B6C6W8_E1B19K-01        -----------------------------------MDVWTILADFSKTRR
M0QU41_E1B19K-01        -----------------------------------MDVWTILADFSKTRR
F1DT57_E1B19K-01        -----------------------------------MDVWTILADFSKTRR
B2VQE3_E1B19K-01        -----------------------------------MDVWTILADFSKTRR
B9A681_E1B19K-01        -----------------------------------MDVWTILADFSKTRR
A0A1Y1BYF1_E1B19K-      -----------------------------------MDVWTILADFSKTRR
B6DU90_E1B19K-01        -----------------------------------MDVWTILADFSKTRR
T1UHZ2_E1B19K-01        -----------------------------------MDVWTILADFSKTRR
A0A291B0H2_E1B19K-      -----------------------------------MDVWTILGDFSKTRR
B9A5Q1_E1B19K-01        -----------------------------------MDVWTILADFSKTRR
M0QUB4_E1B19K-01        -----------------------------------MDVWTILADFSKTRR
M0QUJ3_E1B19K-01        -----------------------------------MDVWTILADFSKTRR
M0QUN2_E1B19K-01        -----------------------------------MDVWTILADFSKTRR
C4P207_E1B19K-01        -----------------------------------MDVWTILADFSKTRR
E1CIM6_E1B19K-01        -----------------------------------MDVWTILADFSKTRR
D4N3H6_E1B19K-01        -----------------------------------MDVWTILADFSKTRR
M0QVK6_E1B19K-01        -----------------------------------MDVWTILADFSKTRR
M0QVT4_E1B19K-01        -----------------------------------MDVWTILADFSKTRR
E1AI10_E1B19K-01        -----------------------------------MDVWTILADFSKTRR
H0PPE7_E1B19K-01        -----------------------------------MDVWTILADFSKTRR
Q9YL99_E1B19K-01        -----------------------------------MDVWTILADFSKTRR
K7ZLN6_E1B19K-01        -----------------------------------MDVWTILADFSKTRR
E1CIR1_E1B19K-01        -----------------------------------MDVWTILADFSKTRR
T1UHQ8_E1B19K-01        -----------------------------------MDVWTILADFSKTRR
T1ULP4_E1B19K-01        -----------------------------------MDVWTILADFSKTRR
Q7T951_E1B19K-01        -----------------------------------MEVWAILEDLRKTRQ
T1UE63_E1B19K-01        -----------------------------------MEVWAILEDLRKTRQ
Q7T8D8_E1B19K-01        -----------------------------------MEVWAILEDLRKTRQ
Q8B8U7_E1B19K-01        -----------------------------------MEVWAILEDLRKTRQ
Q5UW22_E1B19K-01        -----------------------------------MEVWAILEDLRKTRQ
W6EIX6_E1B19K-01        -----------------------------------MEVWAILEDLRKTRQ
Q3ZL02_E1B19K-01        -----------------------------------MEVWAILEDLRKTRQ
A0A1L7NRH1_E1B19K-      -----------------------------------MEVWAILEDLRKTRQ
T1UFS4_E1B19K-01        -----------------------------------MEVWAILEDLRKTRQ
Q32UI6_E1B19K-01        -----------------------------------MEVWAILEDLRKTRQ
C7SRS7_E1B19K-01        -----------------------------------MEVWAILEDLRKTRQ
J7H4R9_E1B19K-01        -----------------------------------MEVWAILEDLRKTRQ
D2DM83_E1B19K-01        -----------------------------------MEVWAILEDLRKTRQ
J7I6W7_E1B19K-01        -----------------------------------MEVWAILEDLRKTRQ
T1UJX4_E1B19K-01        -----------------------------------MEVWAILEDLRKTRQ
T2CI10_E1B19K-01        -----------------------------------MEVWAILEDLRQTRQ
A0A0K0PX99_E1B19K-      -----------------------------------MEVWAILEDLRQTRL
A0A0K0PX35_E1B19K-      -----------------------------------MEVWAILEDLRQTRL
A0A220VZ73_E1B19K-      -----------------------------------MEVWAILEDLRQTRL
R4HLE1_E1B19K-01        -----------------------------------MEVWAILEDLRQTRL
R4HMC6_E1B19K-01        -----------------------------------MEVWAILEDLRQTRL
I1V161_E1B19K-01        -----------------------------------MEVWAILEDLRQTRL
P03248_E1B19K-02        -----------------------------------MEVWAILEDLRQTRL
Q6RK98_E1B19K-01        -----------------------------------MEVWAILEDLRQTRL
J7I6Q4_E1B19K-01        -----------------------------------MEVWAILEDLRQTRL
J7I6S4_E1B19K-01        -----------------------------------MEVWAILEDLRQTRL
R4HLJ6_E1B19K-01        -----------------------------------MEVWAILEDLRQTRL
R4HLA0_E1B19K-01        -----------------------------------MEVWAILEDLRQTRL
Q2KSL3_E1B19K-01        -----------------------------------MEVWAILEDLRQTRL
Q2Y0J3_E1B19K-01        -----------------------------------MEVWAILEDLRQTKL
Q5EY83_E1B19K-01        -----------------------------------MEVWAILEDLRQTRL
I6LEP5_E1B19K-01        -----------------------------------MEVWAILEDLRQTRL
I6LES1_E1B19K-01        -----------------------------------MEVWAILEDLRQTRL
T1UF50_E1B19K-01        -----------------------------------MKVWAILEDLRQTRL
J7ID56_E1B19K-01        -----------------------------------MEVWAILEDLKQTRL
A0A0B4SJH1_E1B19K-      -----------------------------------MEVWAILEDLKQTRL
A0A075IQ70_E1B19K-      -----------------------------------MEVWAILEDLKQTRL
Q2KS85_E1B19K-01        -----------------------------------MEVWAILEDLRQTRL
Q3ZKW2_E1B19K-01        -----------------------------------MEVWAILEDLRQTRL
K7NG43_E1B19K-01        -----------------------------------MEVWAILEDLRQTRL
Q2KRU2_E1B19K-01        -----------------------------------MEVWAILEDLRQTRL
T1UIP3_E1B19K-01        -----------------------------------MEVWAILEDLRQTRL
Q6QPF3_E1B19K-01        -----------------------------------MEIWTVLEDFHQTRQ
Q6QPB7_E1B19K-01        -----------------------------------MEIWTVLEDFHQTRQ
Q6QPI9_E1B19K-01        -----------------------------------MEIWTVLEDFHQTRQ
P10406_E1B19K-01        -----------------------------------MEIWTVLEDFHKTRQ
Q5GFC7_E1B19K-01        -----------------------------------MEIWTVLEDFHKTRQ
A0A2R3WN62_E1B19K-      -----------------------------------MEIWTVLEDFHKTRQ
Q2KSM8_E1B19K-02        -----------------------------------MEIWTVLEDFYKTRQ
Q2KSG6_E1B19K-02        -----------------------------------MEIWTVLEDFYKTRQ
A0A2L1F392_E1B19K-      -----------------------------------MEIWTVLEDFYKTRQ
Q5GFC8_E1B19K-01        -----------------------------------MEIWTVLEDFHKTRQ
Q6H1D7_E1B19K-01        -----------------------------------MEIWTVLEDFHKTRQ
Q2KSG6_E1B19K-01        -----------------------------------MEIWTVLEDFYKTRQ
Q2KSM8_E1B19K-01        -----------------------------------MEIWTVLEDFYKTRQ
A0A2R3WN16_E1B19K-      -----------------------------------MEIWTVLEDFYKTRQ
A0A2L1F3A2_E1B19K-      -----------------------------------MEIWTVLEDFYKTRQ
G9G841_E1B19K-01        -----------------------------------MEIWTILEDLHKTRQ
Q8UY91_E1B19K-01        -----------------------------------MEIWTVLEDFHKTRQ
                                                                        . 

Q71BY5_E1B19K-01        IICHGGVITEEMAASLLDQLIEEVLC-LNLSLSPSQNRNLQDLPGVLK--
A0A0M4NHE0_E1B19K-      LVELCSNRSSWFGRFLFGSTLCRVVRQVKEEYQSEFEHILSNCPGLFV-S
H9AAK5_E1B19K-01        LVELCSNRSSWFGRFLFGSTLCRVVRQVKEEYQSEFEHILSNCPGLFV-S
G0ZAH2_E1B19K-01        VLQQASKRTGGWSRWLLGNQLVRTVAQVKTDYSEHFEQLLQEQNRLLLNN
A0A1W5PVU4_E1B19K-      VLEEASEDTSVWWRRLFGCRVSQLVVQAKVEYKEEFEKLFSEVPGLVD-S
A0A0M3TH18_E1B19K-      VLEEASEDTSVWWRKLFGCRVSQLVVQAKVEYKEEFEKLFSEVPGLVD-S
A0A097IW62_E1B19K-      VVEEASEQTSGWWRKLFGCRLSCLVVQAKFEYREEFERLFAEVPGLLE-S
A0A0A1EUE4_E1B19K-      LLELASDKTSRLWRFWFGSTLSSVVYRVKKEQEGQFSRLLADIPGVFV-A
A0A2H5AI40_E1B19K-      LLELASDKTSRLWRFWFGSTLSSVVYRVKREQEAQFARLLAETPGVLV-A
A0A2H5AID8_E1B19K-      LLELASDKTSRLWRFWFGSTLSSVVYRVKREQEAQFARLLAETPGVLV-A
A0A2H5AII9_E1B19K-      LLELASDKTSRLWRFWFGSTLSSVVYRVKREQEAQFARLLAETPGVLV-A
A0A2H5AIL0_E1B19K-      LLELASDKTSRLWRFWFGSTLSSVVYRVKREQEAQFARLLAETPGVLV-A
A0A2H5AIN5_E1B19K-      LLELASDKTSRLWRFWFGSTLSSVVYRVKREQEAQFARLLAETPGVLV-A
A0A2H5AIS9_E1B19K-      LLELASDKTSRLWRFWFGSTLSSVVYRVKREQEAQFARLLAETPGVLV-A
A0A2H5AIT6_E1B19K-      LLELASDKTSRLWRFWFGSTLSSVVYRVKREQEAQFARLLAETPGVLV-A
A0A2H5AIU0_E1B19K-      LLELASDKTSRLWRFWFGSTLSSVVYRVKREQEAQFARLLAETPGVLV-A
A0A2H5AIC5_E1B19K-      LLELASDKTSRLWRFWFGSTLSSVVYRVKREQEAQFARLLAETPGVLV-A
D3JIR7_E1B19K-01        LLQYTSKNTSGFWRYLFGSTLCKVVHRVKEDYRKEFENILAGCPGLLA-S
A0A076V686_E1B19K-      LLQHTSRNTSGFWRYLFGSTLSKVVHRVKEDYRNEFENILAGCPGLLA-S
P04492_E1B19K-01        LLQYTSKNTSGFWRYLFGSTLSKVVNRVKEDYREEFENILADCPGLLA-S
G1DE13_E1B19K-01        LLQYTSKNTSGFWRYLFGSTFSKVVHRVKEDYREEFENILTDCPGLLA-S
D0Z5R9_E1B19K-01        LLQYTSKNTSGFWRYLFGSTLSKVVHRVKEDYREEFENILADCPGLLA-S
T1UEX7_E1B19K-01        LLQYTSKNTSGFWRYLFGSTLSKVVHRVKEDYREEFENILADCPGLLA-S
A0A2H5AI99_E1B19K-      LLESASDKTSKFWRFCFGSTLSNVVYRVKKEQAEQFSRLLAEIPGVFV-A
A0A0M3TH31_E1B19K-      LLETACEKTSSCWRFFFGSTLSNVVHRVKREHSEEFSRLVADVPGLFV-S
M9YXY5_E1B19K-01        LLETACEKTSSCWRFFFGSTLSNVVHRVKREHSEEFSRLVADVPGLFV-S
M9YVF6_E1B19K-01        LLETACEKNRSCWRFFFGSTLSNVVHRVKREHSEEFSRLVADVPGLFV-S
A0MK43_E1B19K-01        LLELASDKTSRLWRFWFGSTLSSVVYRVKREQEAQFARLLADTPGVFV-A
A0A2H5AI21_E1B19K-      LLELASDRTSKFWRFCFGSTLSNVLYRVKKEQETQFARLLADTPGVFV-A
A0A0M5L3Y4_E1B19K-      LLELASDRTSKFWRFCFGSTLSNVLYRVKKEQETQFARLLADTPGVFV-A
Q5C8R2_E1B19K-01        LLELASDRTSKFWRFCFGSTLSNVLYRVKKEQETQFARLLADTPGVFV-A
A0A0A1EUB2_E1B19K-      LLELASDRTSKFWRFCFGSTLSNVLYRVKKEQETQFARLLADTPGVFV-A
A0A0A1EUC8_E1B19K-      LLELASDRTSKFWRFCFGSTLSNVLYRVKKEQETQFARLLADTPGVFV-A
A0A2H5AI04_E1B19K-      LLELASDRTSKFWRFCFGSTLSNVLYRVKKEQETQFARLLADTPGVFV-A
A0A2H5AI72_E1B19K-      LLELASDRTSKFWRFCFGSTLSNVLYRVKKEQETQFARLLADTPGVFV-A
A0A2H5AIL3_E1B19K-      LLELASDRTSKFWRFCFGSTLSNVLYRVKKEQETQFARLLADTPGVFV-A
A0A2H4CJZ0_E1B19K-      LLELASARTSTCWRFCFGSTLSNVVYRVKQEYSSRFSELLARYPAVFA-S
H8PFZ1_E1B19K-01        LLELASARTSTCWRFCFGSTLSNVVYRVKQEYSSRFSELLARYPAVFV-S
F4ZCJ8_E1B19K-01        LLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRFAELLSFNPGIFA-S
A0A1S6ELT2_E1B19K-      LLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRFAELLSFNPGIFA-S
B5SNR1_E1B19K-01        LLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRFAELLSFNPGIFA-S
P10544_E1B19K-01        LLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRFAELLSFNPGIFA-S
W0S1G8_E1B19K-01        LLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRFAELLSFNPGIFA-S
A0A142G3J2_E1B19K-      LLELASARTSSCWRILFGSTLANVIYRAKEEYSSRFADLLSHNPGIFA-S
P10543_E1B19K-01        LLELASARTSSCWRILFGSTLTNVIYRAKEEYSSRFADLLSHNPGIFA-S
Q71BY5_E1B19K-02        LLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFD-S
E1ARN8_E1B19K-01        LLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFD-S
A0A2H4PJ75_E1B19K-      LLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFD-S
P03246_E1B19K-01        LLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFD-S
Q6VGV8_E1B19K-01        LLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFD-S
A0A0G2R248_E1B19K-      LLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFD-S
Q6WQ37_E1B19K-01        LLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFD-S
A0A291P1B2_E1B19K-      LLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFD-S
T1UG63_E1B19K-01        LLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFD-S
A0A1U9ALK7_E1B19K-      LLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFD-S
P03247_E1B19K-01        LLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFD-S
J9Z5H0_E1B19K-01        LLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFD-S
J7I6T8_E1B19K-01        LLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFD-S
J9Z4H6_E1B19K-01        LLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFD-S
J9Z4N4_E1B19K-01        LLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGELFD-S
P06501_E1B19K-01        LLELCSNRTSFLWRWLFGTPLSRLVRQVKLEYEKDFERILDQCPGVFE-S
A0A0M4N3Z1_E1B19K-      LLELCSNRTSFLWRWLFGTPLSRLVRQVKLEYEKDFERILDQCPGVFE-S
Q8B6X5_E1B19K-01        LLELCSNRTSFLWRWLFGTPLSRLVRQVKLEYEKDFERILDQCPGVFE-S
H9AAD9_E1B19K-01        LVELCSNRSSWFGRFLFGSTLCRVVRQVKEEYQSEFEHILSNCPGLFV-S
H9AAH3_E1B19K-01        LVELCSNRSSWFGRFLFGSTLCRVVRQVKEEYQSEFEHILSNCPGLFV-S
H9AAA8_E1B19K-01        LLELCSNRASWWKRLLFGTSLCRLVRQVKEEYQSEFEHILSTCQGLFE-S
M9YVA3_E1B19K-01        LLELCSNRDPWWKRLLFGTSLCRLVRQVKEEYQSEFEHILSTCQGLFE-S
F2WTJ7_E1B19K-01        LLELCSNRASWWKRLLFGTSLCRLVRQVKEEYESEFEHILSTCQGLFE-S
F2WTM9_E1B19K-01        LLELCSNRASWWKRLLFGTSLCRLVRQVKEEYESEFEHILSTCQGLFE-S
H9AA76_E1B19K-01        LLELCSNRASWWKRLLFGTSLCRLVRQVKEEYQSEFEHILSTCQGLFE-S
A0A1C8EG46_E1B19K-      LLELCSNRASWWKRLLFGTSLCRLVRQVKEEYQSEFEHILSTCQGLFE-S
H9AAN8_E1B19K-01        LLELCSNRASWWKRLLFGTSLCRLVRQVKEEYQSEFEHILSTCQGLFE-S
H9AAS0_E1B19K-01        LLELCSNRASWWKRLLFGTSLCRLVRQVKEEYQSEFEHILSTCQGLFE-S
H9AAV3_E1B19K-01        LLELCSNRASWWKRLLFGTSLCRLVRQVKEEYQSEFEHILSTCQGLFE-S
H9AAY5_E1B19K-01        LLELCSNRASWWKRLLFGTSLCRLVRQVKEEYQSEFEHILSTCQGLFE-S
A0A1L3INW0_E1B19K-      LLEEASNSTSYCWRFLFGSPLGRFLYRVKKDHQEEFDQLIGLFPTIFE-S
F6KST6_E1B19K-01        LLEEASDRTSYFWRFLCGSPLSRFLNRVKREHRAEFDELLEHLPGLFD-S
F2WTG5_E1B19K-01        LLEEASDRTSYIWRFLFGSPLSRFLYRVKREHLTEFDGLLEQLPGLFD-S
Q695T5_E1B19K-01        LLEEASDRTSYIWRFLFGSPLSRFLYRVKREHLTEFDGLLEQLPGLFD-S
H9TER0_E1B19K-01        LLEEASDRTSYIWRFLFGSPLSRFLHRVKREHLTEFDGLLEQLPGLFD-S
A0A0G2UY10_E1B19K-      LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLD-S
X4Y9D2_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLD-S
C5HDR2_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLD-S
M0QVC7_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLD-S
Q4KSL0_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLD-S
A0A1P7YYY5_E1B19K-      LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFADCSGLLD-S
A0A1P8C849_E1B19K-      LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFADCSGLLD-S
B9A5L5_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFADCSGLLD-S
T1UGY3_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFADCSGLLD-S
A0A1P7YWR9_E1B19K-      LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENIFADCSGLLD-S
A0A1P7YWY2_E1B19K-      LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENIFADCSCLLD-S
A0A1P7YXN8_E1B19K-      LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENIFADCSCLLD-S
B9A5A7_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFADCSGLLD-S
T1UG22_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFADCSGLLD-S
H5T740_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLARLVYTVKKDYQDEFENLFADCSGLLD-S
W8VNG2_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFSDCSGLLD-S
F8UFP5_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFSDCSGLLD-S
M0QV87_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFSDCSGLLD-S
M0QU02_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYQEEFENLFADCSGLLD-S
T1UKV6_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFSDCSGLLD-S
M0QV47_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLARLVYTVKKDYQEEFENLFADCSGLLD-S
M0QUW8_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLARLVYTVKKDYQEEFENLFADCSGLLD-S
E1CIJ0_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLARLVYTVKKDYQEEFENLFADCSGLLD-S
T1UGU0_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLARLVYTVKKDYQEEFENLFADCSGLLD-S
M0QVG6_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFVDCSGLLD-S
X4YVU5_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFVDCSGLLD-S
M0QUS9_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSGLLD-S
G1FBW4_E1B19K-01        LVEDSSDGCSGFWRHWFGSPLSRLVYTVKKDYQEEFENLFADCSGLLD-S
M0QVP5_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYQEEFENLFADCSGLLD-S
T1UKQ0_E1B19K-01        LVEDSSDGCSGFWRHWFGSPLSRLVYTVKKDYQEEFENLFADCSGLLD-S
W8CZB0_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLD-S
G1FC01_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLD-S
G3CK71_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLD-S
T1UGT5_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLD-S
T1UK99_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYQEEFENLFADCSGLLD-S
M0QTS5_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLD-S
M0QV08_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLD-S
G9JUV5_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLD-S
T1UGX3_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSGLLD-S
T1ULJ8_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSGLLD-S
T1UHG3_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSGLLD-S
A0A1J0MS84_E1B19K-      LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLD-S
A0A097I4T0_E1B19K-      LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLD-S
E9P585_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSGLLD-S
A0A1Y1BXT7_E1B19K-      LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSGLLD-S
E5RWD9_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLD-S
M0QU76_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEIENLFADCSGLLD-S
T1UHL7_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLD-S
A0A075TSZ1_E1B19K-      LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSGLLD-S
T1UHH6_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSGLLD-S
T1UKP8_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLD-S
B9A5T7_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLD-S
D3GBW3_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLD-S
M0QUF3_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLD-S
E5RWL1_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLD-S
B6C6W8_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLD-S
M0QU41_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLD-S
F1DT57_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLD-S
B2VQE3_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLD-S
B9A681_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLD-S
A0A1Y1BYF1_E1B19K-      LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLD-S
B6DU90_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLD-S
T1UHZ2_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLD-S
A0A291B0H2_E1B19K-      LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFSDCSGLLD-S
B9A5Q1_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSGLLD-S
M0QUB4_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSGLLD-S
M0QUJ3_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSGLLD-S
M0QUN2_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSGLLD-S
C4P207_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSGLLD-S
E1CIM6_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSGLLD-S
D4N3H6_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSGLLD-S
M0QVK6_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSGLLD-S
M0QVT4_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSGLLD-S
E1AI10_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSGLLD-S
H0PPE7_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSGLLD-S
Q9YL99_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSGLLD-S
K7ZLN6_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSGLLD-S
E1CIR1_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSGLLD-S
T1UHQ8_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLD-S
T1ULP4_E1B19K-01        LVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSGLLD-S
Q7T951_E1B19K-01        LLESASDGVSGFWRFWFASELARVVFRIKQDYKQEFEKLLVDCPGLFE-A
T1UE63_E1B19K-01        LLESASDGVSGFWRFWFASELARVVFRIKQDYKQEFEKLLVDCPGLFE-A
Q7T8D8_E1B19K-01        LLENASDGVSGFWRFWFASELARVVFRIKQDYKQEFEKLLVDCPGLFE-A
Q8B8U7_E1B19K-01        LLENASDGVSGFWRFWFASELARVVFRIKQDYNQEFEKLLVDCPGLFE-A
Q5UW22_E1B19K-01        LLENASDGVSGFWRFWFASELARVVFRIKQDYKQEFEKLLVDCPGLFE-A
W6EIX6_E1B19K-01        LLEDASDGVSGFWRFWFASELARVVFRIKQDYKEEFEKLLLDCPGLFE-A
Q3ZL02_E1B19K-01        LLEDASDGVSGFWRFWFASELARVVFRIKQDYKEEFEKLLVDCPGLFE-A
A0A1L7NRH1_E1B19K-      LLEDASDGVSGFWRFWFASELARVVFRIKQDYKEEFEKLLLDCPGLFE-A
T1UFS4_E1B19K-01        LLEDASDGVSGFWRFWFASELARVVFRIKQDYKEEFEKLLVDCPGLFE-A
Q32UI6_E1B19K-01        LLENASDGVSGFWRFWFASELARVVFRIKQDYKEEFEKLLVDCPGLFE-A
C7SRS7_E1B19K-01        LLENASDGVSGFWRFWFASEIARVVFRIKQDYKEEFEKLLVDCPGLFE-A
J7H4R9_E1B19K-01        LLENASDGVSGFWRFWFASELARVVFRIKQDYKEEFEKLLVDCPGLFE-A
D2DM83_E1B19K-01        LLENASDGVSGFWRFWFASELARVVFRIKQDYKEEFEKLLVDCPGLFE-A
J7I6W7_E1B19K-01        LLENASDGVSGFWRFWFASELARVVFRIKQDYKEEFEKLLVDCPGLFE-A
T1UJX4_E1B19K-01        LLENASDGVSGFWRFWFASELARVVFRIKQDYKEEFEKLLVDCPGLFE-A
T2CI10_E1B19K-01        LLENASDGVSGLWRFWFGGDLARLVFRIKQDYRQEFEKLLDDCPGLFE-A
A0A0K0PX99_E1B19K-      LLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFE-A
A0A0K0PX35_E1B19K-      LLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFE-A
A0A220VZ73_E1B19K-      LLENASDGVSGLWRFCFGGDLARLVFRIKQDYSVEFEKLLDDSPGLFE-A
R4HLE1_E1B19K-01        LLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDNSPGLFE-A
R4HMC6_E1B19K-01        LLENASDGVSGLWRFWFGGDLARLVFRIKQDYSVEFEKLLDDSPGLFE-A
I1V161_E1B19K-01        LLENASDGVSGLWRFWFGGDLARLVFRIKQDYSVEFEKLLDDSPGLFE-A
P03248_E1B19K-02        LLENASDGVSGLWRFWFGGDLARLVFRIKQDYSVEFEKLLDDSPGLFE-A
Q6RK98_E1B19K-01        LLENASDGVSGLWRFWFGGDLARLVFRIKQDYSVEFEKLLDDSPGLFE-A
J7I6Q4_E1B19K-01        LLENASDGVSGLWRFWFGGDLARLVFRIKQDYSVEFEKLLDDSPGLFE-A
J7I6S4_E1B19K-01        LLENASDGVSGLWRFWFGGDLARLVFRIKQDYSVEFEKLLDDSPGLFE-A
R4HLJ6_E1B19K-01        LLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFE-A
R4HLA0_E1B19K-01        LLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFE-A
Q2KSL3_E1B19K-01        LLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFE-A
Q2Y0J3_E1B19K-01        LLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFE-A
Q5EY83_E1B19K-01        LLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDIPGLFE-A
I6LEP5_E1B19K-01        LLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFE-A
I6LES1_E1B19K-01        LLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFE-A
T1UF50_E1B19K-01        LLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFE-A
J7ID56_E1B19K-01        LLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFE-A
A0A0B4SJH1_E1B19K-      LLENASDGVSGFWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFE-A
A0A075IQ70_E1B19K-      LLENASDGVSGFWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFE-A
Q2KS85_E1B19K-01        LLENASDGVSGFWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFE-A
Q3ZKW2_E1B19K-01        LLENASDGVSGFWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFE-A
K7NG43_E1B19K-01        LLENASDGVSGFWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFE-A
Q2KRU2_E1B19K-01        LLENASDGVSGFWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFE-A
T1UIP3_E1B19K-01        LLENASDGVSGFWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPGLFE-A
Q6QPF3_E1B19K-01        LLENSSEGVSYLWRFCFGGPLAKLVYRAKQDYKEQFEDILRECPGIFD-S
Q6QPB7_E1B19K-01        LLENSSEGVSYLWRFCFGGPLAKLVYRAKQDYKDQFEDILRECPGIFD-S
Q6QPI9_E1B19K-01        LLENSSEGVSYLWRFCFGGPLAKLVYRAKQDYKDQFEDILRECPGIFD-S
P10406_E1B19K-01        LLENASNGVSHLWRFCFGGDLAKLVYRAKQDYREQFEDILRECPSLFD-A
Q5GFC7_E1B19K-01        LLENASNGVSYLWRFCFGGDLAKLVYRAKQDYREQFEDILRECPGLFD-A
A0A2R3WN62_E1B19K-      LLENASNGVSYLWRFCFGGDLAKLVYRAKQDYREQFEDILRECPGLFD-A
Q2KSM8_E1B19K-02        LLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQFDDILKECPGLFD-A
Q2KSG6_E1B19K-02        LLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQFDDILKECPGLFD-A
A0A2L1F392_E1B19K-      LLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQFDDILKECPGLFD-A
Q5GFC8_E1B19K-01        LLENASNGVSYLWRFCFGGDLAKLVYRAKQDYREQFEDILRECPGLFD-A
Q6H1D7_E1B19K-01        LLENASNGVSYLWRFCFGGDLAKLVYRAKQDYREQFEDILRECPGLFD-A
Q2KSG6_E1B19K-01        LLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQFDDILKECPGLFD-A
Q2KSM8_E1B19K-01        LLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQFDDILKECPGLFD-A
A0A2R3WN16_E1B19K-      LLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQFDDILKECPGLFD-A
A0A2L1F3A2_E1B19K-      LLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQFDDILKECPGLFD-A
G9G841_E1B19K-01        LLENASNGVSHLWRFCFGGDLAKLVYRAKQDYSEQFEVILRECPGLFD-A
Q8UY91_E1B19K-01        LLENASNGVSYLWRFCFGGDLARLVYRAKQDYSEQFEVILRECSGLFD-A
                        ::                      :   : .        .     :.   

Q71BY5_E1B19K-01        --------------------------------------WC----------
A0A0M4NHE0_E1B19K-      LDLGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFLLDRWN-AQTQLSPGY
H9AAK5_E1B19K-01        LDLGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFLLDRWN-AQTQLSPGY
G0ZAH2_E1B19K-01        LELGHTRALNG-VLRELDFENTGRVVAGLAFLAYLLDRWD-ENSVLSPGY
A0A1W5PVU4_E1B19K-      LNFCHHAFFYEKVICGLDFCTPGRTIAALAFCAFILDKWN-KETHLSRGY
A0A0M3TH18_E1B19K-      LNFCHHAFFYEKVICGLDFCTPGRTIAALAFCAFILDKWN-KETHLSKGY
A0A097IW62_E1B19K-      LNFCHHAVFYEKIICSLDFCTPGRTIAALAFCTYILDRWN-KETHLSAGY
A0A0A1EUE4_E1B19K-      LDLGHHSLFQEKIVKSLTFSSPGRTVVSAAFITYILDQWSSSGSHLSWDY
A0A2H5AI40_E1B19K-      LDLGHHSLFQEKIIRNLTFSSPGRTVASAAFVAYILDQWSNSNSHLSWEY
A0A2H5AID8_E1B19K-      LDLGHHSLFQEKIIRNLTFSSPGRTVASAAFVAYILDQWSNSDSHLSWEY
A0A2H5AII9_E1B19K-      LDLGHHSLFQEKIIRNLTFSSPGRTVASAAFVAYILDQWSNSNSHLSWEY
A0A2H5AIL0_E1B19K-      LDLGHHSLFQEKIIRNLTFSSPGRTVASAAFVAYILDQWSNSDSHLSWEY
A0A2H5AIN5_E1B19K-      LDLGHHSLFQEKIIRNLTFSSPGRTVASAAFVAYILDQWSNSNSHLSWEY
A0A2H5AIS9_E1B19K-      LDLGHHSLFQEKIIRNLTFSSPGRTVASAAFVAYILDQWSNSDSHLSWEY
A0A2H5AIT6_E1B19K-      LDLGHHSLFQEKIIRNLTFSSPGRTVASAAFVAYILDQWSNSDSHLSWEY
A0A2H5AIU0_E1B19K-      LDLGHHSLFQEKIIRNLTFSSPGRTVASAAFVAYILDQWSNSNSHLSWEY
A0A2H5AIC5_E1B19K-      LDLGHHSLFQEKIIRNLTFSSPGRTVASAAFITYILDQWSNSDSHLSWEY
D3JIR7_E1B19K-01        LDLCHHSIFQEKVVKSLDFSSAGRTVASIAFLVTVLDKWS-QTSQLSWDY
A0A076V686_E1B19K-      LDLCHHSIFQEKVVRSLDFSSAGRTVASIAFLVTVLDKWS-QASQLSWDY
P04492_E1B19K-01        LDLCYHLVFQEKVVRSLDFSSVGRTVASIAFLATILDKWS-EKSHLSWDY
G1DE13_E1B19K-01        LDLCHHSVFQERVVRSLDFSSSGRTVASIAFLVTVLDKWS-ERSHLSWDY
D0Z5R9_E1B19K-01        LDLCHHSVFQERVVRSLDFSSSGRTVASIAFLATVLDKWS-ERSHLSWDY
T1UEX7_E1B19K-01        LDLCHHSVFQERVVRSLDFSSSGRTVASIAFLATVLDKWS-ERSHLSWDY
A0A2H5AI99_E1B19K-      LDLGHHALFQEKVIKSLTFSSPGRVVTSLAFICHLLDKWS-SDSHLSWNY
A0A0M3TH31_E1B19K-      LDLGHHSYFQEKIVKGLVFESTGRTVVSVAFICFLLDKWS-SDSHLSWDY
M9YXY5_E1B19K-01        LDLGHHSYFQEKIVKGLVFESTGRTVVSVAFICFLLDKWS-SDSHLSWDY
M9YVF6_E1B19K-01        LDLGHHSYFQEKIVKGLVFESTGRTVVSVAFICFLLDKWS-SDSHLSWDY
A0MK43_E1B19K-01        LDLGHHSLFQEKIIKNLTFTSPGRTVASAAFITYILDQWSNSDSHLSWEY
A0A2H5AI21_E1B19K-      LDLGHHSLFQEKIIKNLTFTSPGRTVASAAFITYILDQWSNSDSHLSWEY
A0A0M5L3Y4_E1B19K-      LDLGHHSLFQEKIIKNLTFTSPGRTVASAAFITYILDQWSNSDSHLSWEY
Q5C8R2_E1B19K-01        LDLGHHSLFQEKIIKNLTFTSPGRTVASAAFITYILDQWSNSDSHLSWEY
A0A0A1EUB2_E1B19K-      LDLGHHSLFQEKIIKNLTFTSPGRTVASAAFITYILDQWSNSGSHLSWEY
A0A0A1EUC8_E1B19K-      LDLGHHSLFQEKIIKNLTFTSPGRTVASAAFITYILDQWSNSGSHLSWEY
A0A2H5AI04_E1B19K-      LDLGHHSLFQEKIIKNLTFTSPGRTVASAAFITYILDQWSNSGSHLSWEY
A0A2H5AI72_E1B19K-      LDLGHHSLFQEKIIKNLTFTSPGRTVASAAFITYILDQWSNSGSHLSWEY
A0A2H5AIL3_E1B19K-      LDLGHHSLFQEKIIKNLTFTSPGRTVASAAFITYILDQWSNSGSHLSWEY
A0A2H4CJZ0_E1B19K-      LDLGHHVYFQEAVVRYLDFSTPGRTVSALAFICFVLDRWS-AQTRLSPGY
H8PFZ1_E1B19K-01        LDLGHHVYFQEAVVRYLDFSTPGRAVSAIAFICFVLDRWS-AQTRLSPGY
F4ZCJ8_E1B19K-01        LNLGHHSFFQEIVIKNLDFSSPGRTVSGLAFICFILDQWS-AQTHLSEGY
A0A1S6ELT2_E1B19K-      LNLGHHSFFQEIVIKNLDFSSPGRTVSGLAFICFILDQWS-AQTHLSEGY
B5SNR1_E1B19K-01        LNLGHHSFFQEIVIKNLDFSSPGRTVSGLAFICFILDQWS-AQTHLSEGY
P10544_E1B19K-01        LNLGHHSFFQEIVIKNLDFSSPGRTVSGLAFICFILDQWS-AQTHLSEGY
W0S1G8_E1B19K-01        LNLGHHSFFQEIVIKNLDFSSPGRTVSGLAFICFILDQWS-AQTHLSEGY
A0A142G3J2_E1B19K-      LNLGHHSFFQEIVIRNLDFSSPGRTVSGLAFICFILDQWS-AQTHLSQGY
P10543_E1B19K-01        LNLGHHSFFQEIVIRNLDFSSPGRTVSGLAFICFILDQWS-AQTHLSQGY
Q71BY5_E1B19K-02        LNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSGGY
E1ARN8_E1B19K-01        LNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSGGY
A0A2H4PJ75_E1B19K-      LNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSGGY
P03246_E1B19K-01        LNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSGGY
Q6VGV8_E1B19K-01        LNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSGGY
A0A0G2R248_E1B19K-      LNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSGGY
Q6WQ37_E1B19K-01        LNLGHQALLQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSGGY
A0A291P1B2_E1B19K-      LNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSGGY
T1UG63_E1B19K-01        LNLGHQALFQEKVIKTLDFSTPGRTAAAVAFLSFIKDKWS-EETHLSGGY
A0A1U9ALK7_E1B19K-      LNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSGGY
P03247_E1B19K-01        LNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSGGY
J9Z5H0_E1B19K-01        LNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSGGY
J7I6T8_E1B19K-01        LNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSGGY
J9Z4H6_E1B19K-01        LNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSGGY
J9Z4N4_E1B19K-01        LNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSGGY
P06501_E1B19K-01        LELGYHKVFEEKIVKELDFSSPGRAVAAVAFASYLLDRWN-TRTHLSPGY
A0A0M4N3Z1_E1B19K-      LELGYHKVFEDKIVKELDFSSPGRAVAAVAFASYLLDRWN-TRTHLSPGY
Q8B6X5_E1B19K-01        LELGYHKVFEDKIVKELDFSSPGRAVAAVAFASYLLDRWN-TRTHLSPGY
H9AAD9_E1B19K-01        LDLGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFLLDRWN-AQTQLSPGY
H9AAH3_E1B19K-01        LDLGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFLLDRWN-AQTQLSPGY
H9AAA8_E1B19K-01        LELGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFILDRWN-TQTQLSPGY
M9YVA3_E1B19K-01        LELGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFILDRWN-TQTQLSPGY
F2WTJ7_E1B19K-01        LELGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFILDRWN-SQTQLSPGY
F2WTM9_E1B19K-01        LELGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFILDRWN-SQTQLSPGY
H9AA76_E1B19K-01        LELGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFILDRWN-TQTQLSPGY
A0A1C8EG46_E1B19K-      LELGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFILDRWN-TQTQLSPGY
H9AAN8_E1B19K-01        LELGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFILDRWN-TQTQLSPGY
H9AAS0_E1B19K-01        LELGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFILDRWN-TQTQLSPGY
H9AAV3_E1B19K-01        LELGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFILDRWN-TQTQLSPGY
H9AAY5_E1B19K-01        LELGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFILDRWN-TQTQLSPGY
A0A1L3INW0_E1B19K-      LNLGHKTLLEDKLLVQLDFSTPGRACSGLAFVVHLLDRWN-QETYLSPGY
F6KST6_E1B19K-01        LNLGHRVLLEERLFPQLDFSSPGRLCSALAFVVHLLDRWN-EQTQLSPGY
F2WTG5_E1B19K-01        LNLGHRTLLEERLFPQLDFSSPGRLCSALAFAVHLLDRWN-EQTQLSPGY
Q695T5_E1B19K-01        LNLGHRTLLEERLFPQLDFSSPGRLCSALAFAVHLLDRWN-EQTQLSPGY
H9TER0_E1B19K-01        LNLGHRTLLEERLFPQLDFSSPGRLCSALAFAVHLLDRWN-EQTQLSPGY
A0A0G2UY10_E1B19K-      LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRGY
X4Y9D2_E1B19K-01        LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWR-QDTQLSRGY
C5HDR2_E1B19K-01        LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRGY
M0QVC7_E1B19K-01        LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRGY
Q4KSL0_E1B19K-01        LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRGY
A0A1P7YYY5_E1B19K-      LNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRGY
A0A1P8C849_E1B19K-      LNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRGY
B9A5L5_E1B19K-01        LNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRGY
T1UGY3_E1B19K-01        LNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRGY
A0A1P7YWR9_E1B19K-      LNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRGY
A0A1P7YWY2_E1B19K-      LNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRGY
A0A1P7YXN8_E1B19K-      LNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRGY
B9A5A7_E1B19K-01        LNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRGY
T1UG22_E1B19K-01        LNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRGY
H5T740_E1B19K-01        LNLGHQALFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QQTHLTRDY
W8VNG2_E1B19K-01        LNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRGY
F8UFP5_E1B19K-01        LNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRGY
M0QV87_E1B19K-01        LNFGHQSLFQERVLHSLDFSTPGRTTAGVAFVVFLVDKWS-QDTQLSRGY
M0QU02_E1B19K-01        LNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRGY
T1UKV6_E1B19K-01        LNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRGY
M0QV47_E1B19K-01        LNLGHQALFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QQTHLTRDY
M0QUW8_E1B19K-01        LNLGHQALFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QQTHLTRDY
E1CIJ0_E1B19K-01        LNLGHQALFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QQTHLTRDY
T1UGU0_E1B19K-01        LNLGHQALFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QQTHLTRDY
M0QVG6_E1B19K-01        LNLGHQALFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QQTHLTRDY
X4YVU5_E1B19K-01        LNLGHQALFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QQTHLTRDY
M0QUS9_E1B19K-01        LNLGHQALFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRGY
G1FBW4_E1B19K-01        LNLGHQALFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QQTHLTRDY
M0QVP5_E1B19K-01        LNLGHQALFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QQTHLTRDY
T1UKQ0_E1B19K-01        LNLGHQALFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QQTHLTRDY
W8CZB0_E1B19K-01        LNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRGY
G1FC01_E1B19K-01        LNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRGY
G3CK71_E1B19K-01        LNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRGY
T1UGT5_E1B19K-01        LNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRGY
T1UK99_E1B19K-01        LNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QQTHLTRDY
M0QTS5_E1B19K-01        LNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRGY
M0QV08_E1B19K-01        LNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRGY
G9JUV5_E1B19K-01        LNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRGY
T1UGX3_E1B19K-01        LNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRGY
T1ULJ8_E1B19K-01        LNLGHQALFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRGY
T1UHG3_E1B19K-01        LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRGY
A0A1J0MS84_E1B19K-      LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRGY
A0A097I4T0_E1B19K-      LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRGY
E9P585_E1B19K-01        LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRGY
A0A1Y1BXT7_E1B19K-      LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRGY
E5RWD9_E1B19K-01        LNLGHQSLFQERVLHSLDFSSPGRTTAGVACVVFLVDKWS-QNTQLSRGY
M0QU76_E1B19K-01        LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRGY
T1UHL7_E1B19K-01        LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRGY
A0A075TSZ1_E1B19K-      LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRGY
T1UHH6_E1B19K-01        LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRGY
T1UKP8_E1B19K-01        LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRGY
B9A5T7_E1B19K-01        LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRGY
D3GBW3_E1B19K-01        LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRGY
M0QUF3_E1B19K-01        LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRGY
E5RWL1_E1B19K-01        LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRGY
B6C6W8_E1B19K-01        LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRGY
M0QU41_E1B19K-01        LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRGY
F1DT57_E1B19K-01        LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRGY
B2VQE3_E1B19K-01        LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRGY
B9A681_E1B19K-01        LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRGY
A0A1Y1BYF1_E1B19K-      LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRGY
B6DU90_E1B19K-01        LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRGY
T1UHZ2_E1B19K-01        LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSRGY
A0A291B0H2_E1B19K-      LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRGY
B9A5Q1_E1B19K-01        LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRGY
M0QUB4_E1B19K-01        LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRGY
M0QUJ3_E1B19K-01        LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRGY
M0QUN2_E1B19K-01        LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRGY
C4P207_E1B19K-01        LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRGY
E1CIM6_E1B19K-01        LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRGY
D4N3H6_E1B19K-01        LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRGY
M0QVK6_E1B19K-01        LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRGY
M0QVT4_E1B19K-01        LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRGY
E1AI10_E1B19K-01        LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRGY
H0PPE7_E1B19K-01        LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRGY
Q9YL99_E1B19K-01        LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRGY
K7ZLN6_E1B19K-01        LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRGY
E1CIR1_E1B19K-01        LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRGY
T1UHQ8_E1B19K-01        LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRGY
T1ULP4_E1B19K-01        LNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSRGY
Q7T951_E1B19K-01        LNLGHQVHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSRGY
T1UE63_E1B19K-01        LNLGHQVHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSRGY
Q7T8D8_E1B19K-01        LNLGHQVHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSRGY
Q8B8U7_E1B19K-01        LNLGHQVHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSRGY
Q5UW22_E1B19K-01        LNLGHQVHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSRGY
W6EIX6_E1B19K-01        LNLGHQVHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSRGY
Q3ZL02_E1B19K-01        LNLGHQVHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSRGY
A0A1L7NRH1_E1B19K-      LNLGHQVHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSRGY
T1UFS4_E1B19K-01        LNLGHQVHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSRGY
Q32UI6_E1B19K-01        LNLGHQVHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSRGY
C7SRS7_E1B19K-01        LNLGHQVHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSRGY
J7H4R9_E1B19K-01        LNLGHQVHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSRGY
D2DM83_E1B19K-01        LNLGHQVHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSRGY
J7I6W7_E1B19K-01        LNLGHQVHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSRGY
T1UJX4_E1B19K-01        LNLGHQVHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSRGY
T2CI10_E1B19K-01        LNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFIFDKWI-PQTHFSKGY
A0A0K0PX99_E1B19K-      LNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSRGY
A0A0K0PX35_E1B19K-      LNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKGY
A0A220VZ73_E1B19K-      LNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKGY
R4HLE1_E1B19K-01        LNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKGY
R4HMC6_E1B19K-01        LNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKGY
I1V161_E1B19K-01        LNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKGY
P03248_E1B19K-02        LNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKGY
Q6RK98_E1B19K-01        LNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKGY
J7I6Q4_E1B19K-01        LNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKGY
J7I6S4_E1B19K-01        LNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKGY
R4HLJ6_E1B19K-01        LNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKGY
R4HLA0_E1B19K-01        LNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKGY
Q2KSL3_E1B19K-01        LNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKGY
Q2Y0J3_E1B19K-01        LNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKGY
Q5EY83_E1B19K-01        LNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKGY
I6LEP5_E1B19K-01        LNLGHRAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKGY
I6LES1_E1B19K-01        LNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKGY
T1UF50_E1B19K-01        LNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKGY
J7ID56_E1B19K-01        LNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKGY
A0A0B4SJH1_E1B19K-      LNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKGY
A0A075IQ70_E1B19K-      LNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKGY
Q2KS85_E1B19K-01        LNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKGY
Q3ZKW2_E1B19K-01        LNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKGY
K7NG43_E1B19K-01        LNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKGY
Q2KRU2_E1B19K-01        LNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKGY
T1UIP3_E1B19K-01        LNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSKGY
Q6QPF3_E1B19K-01        LNLGHQSHFNQSILRALDFSTPGRTTAAVAFFAFILDKWS-QETHFSRDY
Q6QPB7_E1B19K-01        LNLGHQSHFNQSILRALDFSTPGRTTAAVAFFAFILDKWS-QETHFSRDY
Q6QPI9_E1B19K-01        LNLGHQSHFNQSILRALDFSTPGRTTAAVAFFAFILDKWS-QETHFSRDY
P10406_E1B19K-01        LNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFIFDKWS-QETHFSRDY
Q5GFC7_E1B19K-01        LNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFIFDKWS-QETHFSRDY
A0A2R3WN62_E1B19K-      LNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFIFDKWS-QETHFSRDY
Q2KSM8_E1B19K-02        LNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFVLDKWS-QETHFSRDY
Q2KSG6_E1B19K-02        LNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFVLDKWS-QETHFSRDY
A0A2L1F392_E1B19K-      LNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFVLDKWS-QETHFSRDY
Q5GFC8_E1B19K-01        LNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFIFDKWS-QETHFSRDY
Q6H1D7_E1B19K-01        LNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFIFDKWS-QETHFSRDY
Q2KSG6_E1B19K-01        LNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFVLDKWS-QETHFSRDY
Q2KSM8_E1B19K-01        LNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFVLDKWS-QETHFSRDY
A0A2R3WN16_E1B19K-      LNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFVLDKWS-QETHFSRDY
A0A2L1F3A2_E1B19K-      LNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFVLDKWS-QETHFSRDY
G9G841_E1B19K-01        LNLGHQTHFNQRIVRALDFTTPGRSTAAVAFFAFLLDKWS-QETHFSRDY
Q8UY91_E1B19K-01        LNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFILDKWS-QETHFSRDY
                                                              *           

Q71BY5_E1B19K-01        -------------LLS----------------------------------
A0A0M4NHE0_E1B19K-      TLDYISLQLWRFWLRR------------RVYNYSRGLPPLGLASVAEERS
H9AAK5_E1B19K-01        TLDYISLQLWRFWLRR------------RVYNYSRGLPPLGLASVAEERS
G0ZAH2_E1B19K-01        RLDCLALAIWKHTLREGILRGVMQGPRARVNREIRREVEERLTQVQRELE
A0A1W5PVU4_E1B19K-      TLDYISLQLWKAYMRK---------G---KIYTFSQGPRSLPQRVRRRLG
A0A0M3TH18_E1B19K-      TLDYISLQLWKAYMRK---------GKIYTFSQGPRSLPQ---RVRRRLG
A0A097IW62_E1B19K-      TLDYITLQLWKAYMRK---------GKIYTFSREPRSLQRLQTSLRRRLG
A0A0A1EUE4_E1B19K-      MLDYLAMALWRAMLRR---------R---VCIYSRAQPPRLDRVVEEDE-
A0A2H5AI40_E1B19K-      MLDYMAMALWRAMLRR---------R---VCIYLRAQPPRLDRVVEENE-
A0A2H5AID8_E1B19K-      MLDYMAMALWRAMLRR---------R---VCIYLRAQPPRLDRVVEENE-
A0A2H5AII9_E1B19K-      MLDYMAMALWRAMLRR---------R---VCIYLRAQPPRLDRVVEENE-
A0A2H5AIL0_E1B19K-      MLDYMAMALWRAMLRR---------R---VCIYLRAQPPRLDRVVEENE-
A0A2H5AIN5_E1B19K-      MLDYMAMALWRAMLRR---------R---VCIYLRAQPPRLDRVVEENE-
A0A2H5AIS9_E1B19K-      MLDYMAMALWRAMLRR---------R---VCIYLRAQPPRLDRVVEENE-
A0A2H5AIT6_E1B19K-      MLDYMAMALWRAMLRR---------R---VCIYLRAQPPRLDRVVEENE-
A0A2H5AIU0_E1B19K-      MLDYMAMALWRAMLRR---------R---VCIYLRAQPPRLDRVVEENE-
A0A2H5AIC5_E1B19K-      MLDYMAMALWRAMLRR---------R---VCIYLRAQPPRLDRVVEENE-
D3JIR7_E1B19K-01        MLDYMAMQLWRAWLTR---------R--VCI-YSLARPLT-MPRLPTLQE
A0A076V686_E1B19K-      MLDYMTMQLWRAWLTR---------R--VCI-YSLARPLT-MPRLPTLQE
P04492_E1B19K-01        MLDYMSMQLWRAWLKR---------R--VCI-YSLARPLT-MPPLPTLQE
G1DE13_E1B19K-01        MLDYMAMHLWRAWLKR---------R--VCI-YSLARPLT-MPPL-----
D0Z5R9_E1B19K-01        MLDYMAMHLWRAWLKR---------R--VCI-YSLARPLT-MPPL-----
T1UEX7_E1B19K-01        MLDYMAMHLWRAWLKR---------R--VCI-YSLARPLT-MPPL-----
A0A2H5AI99_E1B19K-      MLDYLSMAVWRAML-R---------K--RVCIYLRAQPPR-LDRVE--EE
A0A0M3TH31_E1B19K-      MLDYMTMALWRALLRR---------R--RACIYLPVQPQRGLERVE--EE
M9YXY5_E1B19K-01        MLDYMTMALWRALLRR---------R--RACIYLPVQPQRGLERVE--EE
M9YVF6_E1B19K-01        MLDYMTMALWRALLRR---------R--RACIYLPVQPQQGLERVE--EE
A0MK43_E1B19K-01        MLDYMAMALWRAMLRR---------R--VCI-YLRAQPPR-LDRVV--EE
A0A2H5AI21_E1B19K-      MLDYMAMALWRAMLRR---------R--VCI-YLRAQPPR-LDRVV--EE
A0A0M5L3Y4_E1B19K-      MLDYMAMALWRAMLRR---------R--VCI-YLRAQPPR-LDRVV--EE
Q5C8R2_E1B19K-01        MLDYMAMALWRAMLRR---------R--VCI-YLRAQPPR-LDRVV--EE
A0A0A1EUB2_E1B19K-      MLDYMSMALWRAMLRR---------R--VCI-YLRAQPPR-LGRVE--EE
A0A0A1EUC8_E1B19K-      MLDYMSMALWRAMLRR---------R--VCI-YLRAQPPR-LDRVE--EE
A0A2H5AI04_E1B19K-      MLDYMSMALWRAMLRR---------R--VCI-YLRAQPPR-LDRVE--EE
A0A2H5AI72_E1B19K-      MLDYMSMALWRAMLRR---------R--VCI-YLRAQPPR-LDRVE--EE
A0A2H5AIL3_E1B19K-      MLDYMSMALWRAMLRR---------R--VCI-YLRAQPPR-LDRVE--EE
A0A2H4CJZ0_E1B19K-      TLDYLTMSLWRAMLRK---------R--RVSGFSPARPPHGLDPVL--EE
H8PFZ1_E1B19K-01        TLDYLTMSLWRAMLRK---------R--RVSGFSPARPPHGLDPVL--EE
F4ZCJ8_E1B19K-01        TLDYMTMALWRTLLRR---------K--RVLGCSPAQPPHGLDPVREEEE
A0A1S6ELT2_E1B19K-      TLDYMTMALWRTLLRR---------K--RVLGCSPAQPPHGLDPVR-EEE
B5SNR1_E1B19K-01        TLDYMTMALWRTLLRR---------K--RVLGCSPAQPPHGLDPVR-EEE
P10544_E1B19K-01        TLDYMTMALWRTLLRR---------K--RVLGCSPAQPPHGLDPVR---E
W0S1G8_E1B19K-01        TLDYMTMALWRTLLRR---------K--RVLGCSPAQPPHGLDPVR---E
A0A142G3J2_E1B19K-      TLDYMAMALWRTLLRR---------K--RVLGCLPAQRPHGLDPVQ----
P10543_E1B19K-01        TLDYMAMALWRTLLRR---------K--RVLGCLPAQRPHGLDPVQ----
Q71BY5_E1B19K-02        LLDFLAMHLWRAVVRH---------K-----NRLLLLSSVRPAIIPTEE-
E1ARN8_E1B19K-01        LLDFLAMHLWRAVVRH---------K-----NRLLLLSSVRPAIIPTEE-
A0A2H4PJ75_E1B19K-      LLDFLAMHLWRAVVRH---------K-----NRLLLLSSVRPAIIPTEE-
P03246_E1B19K-01        LLDFLAMHLWRAVVRH---------K-----NRLLLLSSVRPAIIPTEE-
Q6VGV8_E1B19K-01        LLDFLAMHLWRAVVRH---------K-----NRLLLLSSVRPAIIPTEE-
A0A0G2R248_E1B19K-      LLDFLAMHLWRAVVRH---------K-----NRLLLLSSVRPAIIPTEE-
Q6WQ37_E1B19K-01        LLDFLAMHLWRAVVRH---------K-----NRLLLLSSVRPAIIPTEE-
A0A291P1B2_E1B19K-      LLDFLAMHLWRAVVRH---------K-----NRLLLLSSVRPAIIPTEE-
T1UG63_E1B19K-01        LLDFLAMHLWRAVVRH---------K-----NRLLLLSSVRPAIIPTEEQ
A0A1U9ALK7_E1B19K-      LLDFLAMHLWRAVVRH---------K-----NRLLLLSSVRPAIIPTEE-
P03247_E1B19K-01        LLDFLAMHLWRAVVRH---------K-----NRLLLLSSVRPAIIPTEE-
J9Z5H0_E1B19K-01        LLDFLAMHLWRAVVRH---------K-----NRLLLLSSVRPAIIPTEE-
J7I6T8_E1B19K-01        LLDFLAMHLWRAVVRH---------K-----NRLLLLSSVRPAIIPTEE-
J9Z4H6_E1B19K-01        LLDFLAMHLWRAVVRH---------K-----NRLLLLSSVRPAIIPTEEQ
J9Z4N4_E1B19K-01        LLDFLAMHLWRAVVRH---------K-----NRLLLLSSVRPAIIPTEE-
P06501_E1B19K-01        QMDYISLNLWKFWLRR---------RVYNYSRGL---PQLGPAAPLARQ-
A0A0M4N3Z1_E1B19K-      QMDYISLNLWKFWLRR---------RVYNYSRGL---PQLGPVAPLVRQ-
Q8B6X5_E1B19K-01        QMDYIRLNLWKFWLRR---------RVYNYSRGL---PQLGPVAPLVRQ-
H9AAD9_E1B19K-01        TLDYISLQLWRFWLRR---------RVYNYSRGL---PPLGLASVAEER-
H9AAH3_E1B19K-01        TLDYISLQLWRFWLRR---------RVYNYSRGL---PPLGLASVAEER-
H9AAA8_E1B19K-01        TLDYISLQLWRFWLRR---------RVYNYSRGL---PPLGRASSPEEQ-
M9YVA3_E1B19K-01        TLDYISLQLWRFWLRR---------RVYNYSRGL---PPLGRASSPEEQ-
F2WTJ7_E1B19K-01        TLDYISLQLWRFWLRR---------RVYNYSRGL---PPLGRASLPEEQ-
F2WTM9_E1B19K-01        TLDYISLQLWRFWLRR---------RVYNYSRGL---PPLGRASLPEEQ-
H9AA76_E1B19K-01        TLDYISLQLWRFWLRR---------RVYNYSRGL---PPLGRASSPEEQ-
A0A1C8EG46_E1B19K-      TLDYISLQLWRFWLRR---------RVYNYSRGL---PPLGRASSPEEQ-
H9AAN8_E1B19K-01        TLDYISLQLWRFWLRR---------RVYNYSRGL---PPLGRASSPEEQ-
H9AAS0_E1B19K-01        TLDYISLQLWRFWLRR---------RVYNYSRGL---PPLGRASSPEEQ-
H9AAV3_E1B19K-01        TLDYISLQLWRFWLRR---------RVYNYSRGL---PPLGRASSPEEQ-
H9AAY5_E1B19K-01        TLDYISLQLWRFWLRR---------RVYNYSRGL---PPLGRASSPEEQ-
A0A1L3INW0_E1B19K-      TLDFLTLSLWKTGLKR---------GRKLYGRMLERHPSLIQKTVRAQV-
F6KST6_E1B19K-01        TLDFLTLCLWKFGIRK---------GRKLYRRLVERHPSLRQHRLQAQA-
F2WTG5_E1B19K-01        TLDFLTLCLWKFGIRR---------GRKLYGRLVERHPSLRQQRLQAQV-
Q695T5_E1B19K-01        TLDFLTLCLWKFGIRR---------GRKLYGRLVERHPSLRQQRLQAQV-
H9TER0_E1B19K-01        TLDFLTLCLWKFGIRR---------GRKLYGRLVERHPSLRQQRLQAQV-
A0A0G2UY10_E1B19K-      ILDFAAMHLWRSWIRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
X4Y9D2_E1B19K-01        ILDFAAMHLWRSWIRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
C5HDR2_E1B19K-01        ILDFAAMHLWRAWVRQ---------RGQRILNYWLIQP-AVPGLLRLHRQ
M0QVC7_E1B19K-01        ILDFAAMHLWRAWVRQ---------RGQRILNYWLIQP-AAPGLLRLHRQ
Q4KSL0_E1B19K-01        ILDFAAMHLWRAWIRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
A0A1P7YYY5_E1B19K-      ILDFAAMHLWRAWMRQ---------RGQRILNYWLLQP-AASGLLHLHRQ
A0A1P8C849_E1B19K-      ILDFAAMHLWRAWMRQ---------RGQRILNYWLLQP-AALGLLHLHRQ
B9A5L5_E1B19K-01        ILDFAAMHLWRAWMRQ---------RGQRILNYWLLQP-AASGLLHLHRQ
T1UGY3_E1B19K-01        ILDFAAMHLWRAWMRQ---------RGQRILNYWLLQP-AASGLLHLHRQ
A0A1P7YWR9_E1B19K-      ILDFAAMHLWRAWMRQ---------RGQRILNYWLLQP-AASGLLHLHRQ
A0A1P7YWY2_E1B19K-      ILDFAAMHLWRAWMRQ---------RGQRILNYWLLQP-AASGLLHLHRQ
A0A1P7YXN8_E1B19K-      ILDFAAMHLWRAWMRQ---------RGQRILNYWLLQP-AASGLLHLHRQ
B9A5A7_E1B19K-01        ILDFAAMHLWRAWMRQ---------RGQRILNYWLLQP-AASGLLHLHRQ
T1UG22_E1B19K-01        ILDFAAMHLWRAWMRQ---------RGQRILNYWLLQP-AASGLLHLHRQ
H5T740_E1B19K-01        ILDFTAMHLWKAWVRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
W8VNG2_E1B19K-01        ILDFAAMHLWRAWIRQ---------RGQRILNYWLLQP-AAPGLLHLHRQ
F8UFP5_E1B19K-01        ILDFAAMHLWRAWIRQ---------RGQRILNYWLLQP-AAPGLLHLHRQ
M0QV87_E1B19K-01        ILDFAAMHLWRAWIRQ---------RGQRILNYWLLQP-AVPGLLRLHRQ
M0QU02_E1B19K-01        ILDFAAMHLWRAWIRQ---------RGQRILNYWLLQP-AAPGLLHLHRQ
T1UKV6_E1B19K-01        ILDFAAMHLWRAWIRQ---------RGQRILNYWLLQP-AVPGLLRLHRQ
M0QV47_E1B19K-01        ILDFTAMHLWKAWVRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
M0QUW8_E1B19K-01        ILDFTAMHLWKAWVRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
E1CIJ0_E1B19K-01        ILDFTAMHLWKAWVRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
T1UGU0_E1B19K-01        ILDFTAMHLWKAWVRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
M0QVG6_E1B19K-01        ILDFTAMHLWKAWVRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
X4YVU5_E1B19K-01        ILDFTAMHLWKAWVRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
M0QUS9_E1B19K-01        ILDFTAMHLWRAWVRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
G1FBW4_E1B19K-01        ILDFTAMHLWKAWVRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
M0QVP5_E1B19K-01        ILDFTAMHLWKAWVRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
T1UKQ0_E1B19K-01        ILDFTAMHLWKAWVRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
W8CZB0_E1B19K-01        ILDFAAMHLWRAWVRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
G1FC01_E1B19K-01        ILDFAAMHLWRAWVRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
G3CK71_E1B19K-01        ILDFAAMHLWRAWVRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
T1UGT5_E1B19K-01        ILDFAAMHLWRAWVRQ---------RGQRILNYWLLQP-AVPGLLRLHRQ
T1UK99_E1B19K-01        ILDFTAMHLWKAWVRQ---------RGQRILNYWLLQP-AAPGLLHLHRQ
M0QTS5_E1B19K-01        ILDFAAMHLWRAWVRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
M0QV08_E1B19K-01        ILDFAAMHLWRAWVRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
G9JUV5_E1B19K-01        ILDFAAMHLWRAWVRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
T1UGX3_E1B19K-01        ILDFAAMHLWRAWVRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
T1ULJ8_E1B19K-01        ILDFAAMHLWRAWIRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
T1UHG3_E1B19K-01        ILDFAAMHLWRAWIRQ---------RGQRILNYWLLQP-AAPGLLCLHRQ
A0A1J0MS84_E1B19K-      ILDFAAMHLWRSWVRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
A0A097I4T0_E1B19K-      ILDFAAMHLWRAWVRQ---------RGQRILNYWLIQP-AAPGLLRLHRQ
E9P585_E1B19K-01        ILDFAAMHLWRAWIRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
A0A1Y1BXT7_E1B19K-      ILDFAAMHLWRAWIRQ---------RGQKILNYWLLQP-AAPGLLRLHRQ
E5RWD9_E1B19K-01        ILDFAAMHLWRAWVRQ---------RGQRILNYWLIQP-AAPGLLRLHRQ
M0QU76_E1B19K-01        ILDFAAMHLWRAWVRQ---------RGQRILNYWLIQP-AAPGLLRLHRQ
T1UHL7_E1B19K-01        ILDFAAMHLWRSWIRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
A0A075TSZ1_E1B19K-      ILDFAAMHLWRSWIRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
T1UHH6_E1B19K-01        ILDFAAMHLWRSWIRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
T1UKP8_E1B19K-01        ILDFAAMHLWRSWIRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
B9A5T7_E1B19K-01        ILDFAAMHLWRAWVRQ---------RGQRILNYWLIQP-AAPGLLRLHRQ
D3GBW3_E1B19K-01        ILDFAAMHLWRAWVRQ---------RGQRILNYWLIQP-AVPGLLRLHRQ
M0QUF3_E1B19K-01        ILDFAAMHLWRAWVRQ---------RGQRILNYWLIQP-AAPGLLRLHRQ
E5RWL1_E1B19K-01        ILDFAAMHLWRAWVRQ---------RGQRILNYWLIQP-AAPGLLRLHRQ
B6C6W8_E1B19K-01        ILDFAAMHLWRAWVRQ---------RGQRILNYWLIQP-AAPGLLRLHRQ
M0QU41_E1B19K-01        ILDFAAMHLWRAWVRQ---------RGQRILNYWLIQP-AAPGLLRLHRQ
F1DT57_E1B19K-01        ILDFAAMHLWRAWVRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
B2VQE3_E1B19K-01        ILDFAAMHLWRAWVRQ---------RGQRILNYWLIQP-AAPGLLRLHRQ
B9A681_E1B19K-01        ILDFAAMHLWRAWVRQ---------RGQRILNYWLIQP-AAPGLLRLHRQ
A0A1Y1BYF1_E1B19K-      ILDFAAMHLWRAWVRQ---------RGQRILNYWLIQP-AAPGLLRLHRQ
B6DU90_E1B19K-01        ILDFAAMHLWRAWVRQ---------RGQRILNYWLIQP-AAPGLLRLHRQ
T1UHZ2_E1B19K-01        ILDFAAMHLWRAWVRQ---------RGQRILNYWLIQP-AAPGLLRLHRQ
A0A291B0H2_E1B19K-      ILDFAAMHLWRAWIRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
B9A5Q1_E1B19K-01        ILDFAAMHLWRAWIRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
M0QUB4_E1B19K-01        ILDFAAMHLWRAWIRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
M0QUJ3_E1B19K-01        ILDFAAMHLWRAWIRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
M0QUN2_E1B19K-01        ILDFAAMHLWRAWIRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
C4P207_E1B19K-01        ILDFAAMHLWRAWIRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
E1CIM6_E1B19K-01        ILDFAAMHLWRAWIRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
D4N3H6_E1B19K-01        ILDFAAMHLWRAWIRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
M0QVK6_E1B19K-01        ILDFAAMHLWRAWIRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
M0QVT4_E1B19K-01        ILDFAAMHLWRAWIRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
E1AI10_E1B19K-01        ILDFAAMHLWRAWIRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
H0PPE7_E1B19K-01        ILDFAAMHLWRAWIRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
Q9YL99_E1B19K-01        ILDFAAMHLWRAWIRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
K7ZLN6_E1B19K-01        ILDFAAMHLWRAWIRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
E1CIR1_E1B19K-01        ILDFAAMHLWRAWIRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
T1UHQ8_E1B19K-01        ILDFAAMHLWRAWIRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
T1ULP4_E1B19K-01        ILDFAAMHLWRAWIRQ---------RGQRILNYWLLQP-AAPGLLRLHRQ
Q7T951_E1B19K-01        VLDFIATALWRTWKVR---------KMRTILGYWPVQPLGVAGILRHPPV
T1UE63_E1B19K-01        VLDFIATALWRTWKVR---------KMRTILGYWPVQPLGVAGILRHPPV
Q7T8D8_E1B19K-01        VLDFIATALWRTWKVR---------KMRTILGYWPVQPLGVAGILRHPPV
Q8B8U7_E1B19K-01        VLDFIATALWRTWKVR---------KMRTILGYWPVQPLGVAGILRHPPV
Q5UW22_E1B19K-01        VLDFIATALWRTWKVR---------KMRTILGYWPVQPLGVAGILRHPPV
W6EIX6_E1B19K-01        VLDFIATALWRTWKVR---------KMRTILGYWPVQPLGVAGILRHPPV
Q3ZL02_E1B19K-01        VLDFVATALWRTWKVR---------KMRTILGYWPVQPLGVAGILRHPPV
A0A1L7NRH1_E1B19K-      VLDFIATALWRTWKVR---------KMRTILGYWPVQPLGVAGILRHPPV
T1UFS4_E1B19K-01        VLDFVATALWRTWKVR---------KMRTILGYWPVQPLGVAGILRHPPV
Q32UI6_E1B19K-01        VLDFVATALWRTWKVR---------KMRTILGYWPVQPLGVAGILRHPPV
C7SRS7_E1B19K-01        VLDFVATALWRTWKVR---------KMRTILGYWPVQPLGVAGILRHPPV
J7H4R9_E1B19K-01        VLDFVATALWRTWKVR---------KMRTILGYWPVQPLGVAGILRHPPV
D2DM83_E1B19K-01        VLDFVATALWRTWKVR---------KMRTILGYWPVQPLGVAGILRHPPV
J7I6W7_E1B19K-01        VLDFVATALWRTWKVR---------KMRTILGYWPVQPLGVAGILRHPPV
T1UJX4_E1B19K-01        VLDFIATALWRTWKVR---------KMRTILGYWPVQPLGVAGILRHPPV
T2CI10_E1B19K-01        VLDFIAAALWRTWKAR---------RMRTILDYWPVQPLGVAGILRHPPT
A0A0K0PX99_E1B19K-      VLDFIAAALWRTWKAR---------RMRTILDYWPVQPLGVAGILRHPPA
A0A0K0PX35_E1B19K-      VLDFIAAALWRTWKAR---------RMRTILDYWPVQPLGVAGILRHPPA
A0A220VZ73_E1B19K-      VLDFIAAALWRTWKAR---------RMRTILNYWPVQPLGVAGILRHPPT
R4HLE1_E1B19K-01        VLDFIAAALWRTWKAR---------RMRTILDYWPVQPLGVAGILRHPPT
R4HMC6_E1B19K-01        VLDFIAAALWRTWKAR---------RMRTILNYWPVQPLGVAGILRHPPT
I1V161_E1B19K-01        VLDFIAAALWRTWKAR---------RMRTILNYWPVQPLGVAGILRHPPT
P03248_E1B19K-02        VLDFIAAALWRTWKAR---------RMRTILDYWPVQPLGVAGILRHPPT
Q6RK98_E1B19K-01        VLDFIAAALWRTWKAR---------RMRTILDYWPVQPLGVAGILRHPPT
J7I6Q4_E1B19K-01        VLDFIAAALWRTWKAR---------RMRTILDYWPVQPLGVAGILRHPPT
J7I6S4_E1B19K-01        VLDFIAAALWRTWKAR---------RMRTILNYWPVQPLGVAGILRHPPT
R4HLJ6_E1B19K-01        VLDFIAAALWRTWKAR---------RMRTILDYWPVQPLGVAGILRHPPT
R4HLA0_E1B19K-01        VLDFIAAALWRTWKAR---------RMRTILDYWPVQPLGVAGILRHPPT
Q2KSL3_E1B19K-01        VLDFIAAALWRTWKAR---------RMRTILDYWPVQPLGVAGILRHPPT
Q2Y0J3_E1B19K-01        VLDFIAAALWRTWKAR---------RMRTILDYWPVQPLGVAGILRHPPT
Q5EY83_E1B19K-01        VLDFIAAALWRTWKAR---------RMRTILDYWPVQPLGVAGILRHPPT
I6LEP5_E1B19K-01        VLDFIAAALWRTWKAR---------RMRTILDYWPVQPLGVAGILRHPPT
I6LES1_E1B19K-01        VLDFIAAALWRTWKAR---------RMRTILDYWPVQPLGVAGILRHPPT
T1UF50_E1B19K-01        VLDFIAAALWRTWKAR---------RMRTILDYWPVQPLGVAGILRHPPT
J7ID56_E1B19K-01        VLDFIAAALWRTWKAR---------RMRTILDYWPVQPLGVAGILRHPPT
A0A0B4SJH1_E1B19K-      VLDFIAAALWRTWKAR---------RMRTILDYWPVQPLGVAGILRHPPA
A0A075IQ70_E1B19K-      VLDFIAAALWRTWKAR---------RMRTILDYWPVQPLGVAGILRHPPA
Q2KS85_E1B19K-01        VLDFIAAALWRTWKAR---------RMRTILDYWPVQPLGVAGILRHPPA
Q3ZKW2_E1B19K-01        VLDFIAAALWRTWKAR---------SMRTILDYWPVQPLGVAGILRHPPT
K7NG43_E1B19K-01        VLDFIAAALWRTWKAR---------RMRTILDYWPVQPLGVAGILRHPPA
Q2KRU2_E1B19K-01        VLDFIAAALWRTWKAR---------RMRTILDYWPVQPLGVAGILRHPPA
T1UIP3_E1B19K-01        VLDFIAAALWRTWKAR---------RMRTILDYWPVQPLGVAGILRHPPA
Q6QPF3_E1B19K-01        RLDCLAVALWRTWRCQ---------RLNAISGYLPVQPVDTLRILSLQSP
Q6QPB7_E1B19K-01        RLDCLAVALWRTWRCQ---------RLNAISGYLPVQPVDTLRILSLQSP
Q6QPI9_E1B19K-01        RLDCLAVALWRTWRCQ---------RLNAISGYLPVQPVDTLRILSLQSP
P10406_E1B19K-01        QLDFLAVALWRTWKCQ---------RLNAIPATCRYSR------------
Q5GFC7_E1B19K-01        QLDFLAVALWRTWKCQ---------RLNAIPATCRYSR------------
A0A2R3WN62_E1B19K-      QLDFLAVALWRTWKCQ---------RLNAIPATCRYSR------------
Q2KSM8_E1B19K-02        QLDFLAVALWRAWKCQ---------RLNAIPATCRYSR------------
Q2KSG6_E1B19K-02        QLDFLAVALWRAWKCQ---------RLNAI---CRYSR------------
A0A2L1F392_E1B19K-      QLDFLAVALWRAWKCQ---------RLNAI---CRYSR------------
Q5GFC8_E1B19K-01        QLDFLAVALWRTWKCQ---------RLNAISGYLPVQPLDTLRILSL---
Q6H1D7_E1B19K-01        QLDFLAVALWRTWKCQ---------RLNAISGYLPVQPLDTLRILSL---
Q2KSG6_E1B19K-01        QLDFLAVALWRAWKCQ---------RLNAISGYLPVQPLDTLRILSLQQI
Q2KSM8_E1B19K-01        QLDFLAVALWRAWKCQ---------RLNAISGYLPVQPLDTLRILSLQQI
A0A2R3WN16_E1B19K-      QLDFLAVALWRAWKCQ---------RLNAISGYLPVQPLDTLRILSLQQI
A0A2L1F3A2_E1B19K-      QLDFLAVALWRAWKCQ---------RLNAISGYLPVQPLDTLRILSLQQI
G9G841_E1B19K-01        QLDFLAVALWRTWKSQ---------RLNAISGYLPVQPLDTLKILNLQES
Q8UY91_E1B19K-01        QLDFLAVALWRTWKCQ---------RLNAISGYLPVQPLDTLRILNLQES
                                                                          

Q71BY5_E1B19K-01        --------------------------------------------------
A0A0M4NHE0_E1B19K-      EESKPEVNPEAQG-----EAKEEAL---------------RSGLDPPVEE
H9AAK5_E1B19K-01        EESKPEVNPEAQG-----EAKEETL---------------RSGLDPPVEE
G0ZAH2_E1B19K-01        ERERERQQREREQ-----QQQEGEMTTSIWRPSMEAEWPPRAGMDPPLEE
A0A1W5PVU4_E1B19K-      FQTEDQTRL---------LEAEEEP---------------RAGMDPPSET
A0A0M3TH18_E1B19K-      FKTEDQTRL---------LEAEEEP---------------RAGTDPPSET
A0A097IW62_E1B19K-      MPTDDRVCL---------LEA-ENP---------------RAGMDPPSEN
A0A0A1EUE4_E1B19K-      ------------------PDETENL---------------RAGLDPPMED
A0A2H5AI40_E1B19K-      ------------------PEETENL---------------RAGLDPPVED
A0A2H5AID8_E1B19K-      ------------------PEETENL---------------RAGLDPPVED
A0A2H5AII9_E1B19K-      ------------------PEETENL---------------RAGLDPPVED
A0A2H5AIL0_E1B19K-      ------------------PEETENL---------------RAGLDPPVED
A0A2H5AIN5_E1B19K-      ------------------PEETENL---------------RAGLDPPVED
A0A2H5AIS9_E1B19K-      ------------------PEETENL---------------RAGLDPPVED
A0A2H5AIT6_E1B19K-      ------------------PEETENL---------------RAGLDPPVED
A0A2H5AIU0_E1B19K-      ------------------PEETENL---------------RAGLDPPVED
A0A2H5AIC5_E1B19K-      ------------------PEETENL---------------RAGLDPPVED
D3JIR7_E1B19K-01        E-----------------ELEQR---------------------DPAAEK
A0A076V686_E1B19K-      E-----------------P-EER---------------------DPAVEK
P04492_E1B19K-01        EK----------------EEERN---------------------PAVVEK
G1DE13_E1B19K-01        ------------------QEEQQ---------------------NTTTEE
D0Z5R9_E1B19K-01        ------------------QEEQQ---------------------NTTTEE
T1UEX7_E1B19K-01        ------------------QEEQQ---------------------NTTTEE
A0A2H5AI99_E1B19K-      DE----------------PVETDNP---------------RAGLDPPVED
A0A0M3TH31_E1B19K-      EE------------------ENENP---------------RAGVDPPLE-
M9YXY5_E1B19K-01        EE------------------ENENP---------------RAGVDPPLE-
M9YVF6_E1B19K-01        EE--------------------ENP---------------RAGVDPPLE-
A0MK43_E1B19K-01        NE----------------PEETENL---------------RAGLDPPVED
A0A2H5AI21_E1B19K-      NE----------------PEETENL---------------RAGLDPPVED
A0A0M5L3Y4_E1B19K-      NE----------------PEETENL---------------RAGLDPPVED
Q5C8R2_E1B19K-01        NE----------------PEETENL---------------RAGLDPPVED
A0A0A1EUB2_E1B19K-      DE----------------PGEMENL---------------RAGLDPPTED
A0A0A1EUC8_E1B19K-      DE----------------PGETENL---------------RAGLDPPTED
A0A2H5AI04_E1B19K-      DE----------------PGETENL---------------RAGLDPPTED
A0A2H5AI72_E1B19K-      DE----------------PGETENL---------------RAGLDPPTED
A0A2H5AIL3_E1B19K-      DE----------------PGETENL---------------RAGLDPPTED
A0A2H4CJZ0_E1B19K-      PE----------------PEEEENP---------------RAGLDPSAE-
H8PFZ1_E1B19K-01        SE----------------LEEEENP---------------RAGLDPPAE-
F4ZCJ8_E1B19K-01        EE----------------EEEEENL---------------RAGLDPQTEL
A0A1S6ELT2_E1B19K-      EE----------------EEERENL---------------RAGLDPQTEL
B5SNR1_E1B19K-01        EE----------------EEEEENL---------------RAGLDPQTEL
P10544_E1B19K-01        EE----------------EEEEENL---------------RAGLDPQTEL
W0S1G8_E1B19K-01        EE----------------EEEEENL---------------RAGLDPQTEL
A0A142G3J2_E1B19K-      EE----------------EEEEENL---------------RAGLDPSTEL
P10543_E1B19K-01        EE----------------EEEEENL---------------RAGLDPSTEL
Q71BY5_E1B19K-02        QQQQQQQQEEARRRRRQ-EQSPWNP---------------RAGLDPR-E-
E1ARN8_E1B19K-01        QQQQQQQQEEARRRRRQ-EQSPWNP---------------RAGLDPR-E-
A0A2H4PJ75_E1B19K-      --QQQQQQEEARRRRRQ-EQSPWNP---------------RAGLDPR-E-
P03246_E1B19K-01        ----QQQQQEEARRRRQ-EQSPWNP---------------RAGLDPR-E-
Q6VGV8_E1B19K-01        ----QQQQQEEARRRRQ-EQSPWNP---------------RAGLDPR-E-
A0A0G2R248_E1B19K-      ----QQQQQEEARRRRQ-EQSPWNP---------------RAGLDPR-E-
Q6WQ37_E1B19K-01        ----QQQQQEEARRRRQ-EQSPWNP---------------RAGLDPR-E-
A0A291P1B2_E1B19K-      -----QQQEEARRRRRQ-EQSPWNP---------------RAGLDPR-E-
T1UG63_E1B19K-01        QQQQQQQEEARRRRRRQ-EQSPWNP---------------RAGLDPR-E-
A0A1U9ALK7_E1B19K-      -----QQQEEARRRRRQ-EQSPWNP---------------RAGLDPR-E-
P03247_E1B19K-01        -----QQQEEARRRRRQ-EQSPWNP---------------RAGLDPR-E-
J9Z5H0_E1B19K-01        -----QQQEEARRRRRQ-EQSPWNP---------------RAGLDPR-E-
J7I6T8_E1B19K-01        -QQQQQQQEEARRRRRQ-EQSPWNP---------------RAGLDPR-E-
J9Z4H6_E1B19K-01        QQQQQQQQEEARRRRRQ-EQSPWNP---------------RAGLDPR-E-
J9Z4N4_E1B19K-01        ---QQQQQEEARRRRRQ-EQSPWNP---------------RAGLDPR-E-
P06501_E1B19K-01        -GSQQEE-QQQRQEEEQ-VQE--EM---------------RSGLDPP-TE
A0A0M4N3Z1_E1B19K-      -GSQQEEQQQQRQEEQQ-VQEEGEM---------------RSGLDPP-TE
Q8B6X5_E1B19K-01        -GSQQEEQQQQRQEEQQ-VQEEGEM---------------RSGLDPP-TE
H9AAD9_E1B19K-01        -SEESKPEVNPEAQGEA-KE--ETL---------------RSGLDPPVEE
H9AAH3_E1B19K-01        -SEESKPEVNPEAQGEA-KE--ETL---------------RSGLNPPVEE
H9AAA8_E1B19K-01        -SPEVKPEVAGQGEEQE-QEQKPAL---------------RSGLDPP-EE
M9YVA3_E1B19K-01        -SPEVKPEVAGQGEEQE-QE--PAL---------------RSGLDPP-EE
F2WTJ7_E1B19K-01        -SPEVKPKVAGQGEEQE-QE--PAL---------------RSGLDPP-EE
F2WTM9_E1B19K-01        -SPEVKPKVAGQGEEQE-QE--PAL---------------RSGLDPP-EE
H9AA76_E1B19K-01        -SPEVKPEVAGQGEEQE-PE--PAL---------------RSGLDPP-EE
A0A1C8EG46_E1B19K-      -LPEVKPEVAGQGEEQE-QK--PAL---------------RSGLGPP-EE
H9AAN8_E1B19K-01        -SPEVKPEVAGQGEEQE-QE--PAL---------------RSGLDPP-EE
H9AAS0_E1B19K-01        -SPEVKPEVAGQGEEQE-QE--PAL---------------RSGLDPP-EE
H9AAV3_E1B19K-01        -SPEVKPEVAGQGEEQE-QE--PAL---------------RSGLDPP-EE
H9AAY5_E1B19K-01        -SPEVKPEVAGQGEEQE-QE--PAL---------------RSGLDPP-EE
A0A1L3INW0_E1B19K-      -LSRWGALE---------NLAEEDP---------------RAGLDPP-EE
F6KST6_E1B19K-01        -LLRQEELETILEEEAM-NMEEQNP---------------RAGLDPP-VE
F2WTG5_E1B19K-01        -LLRREDLEAISEEES--GMEE-NP---------------RAGLDPP-AE
Q695T5_E1B19K-01        -LLRREDLEAISEEES--GMEEKNP---------------RAGLDPP-AE
H9TER0_E1B19K-01        -LLRREDLEAISEEES--GMEEKNP---------------RAGLDPP-AE
A0A0G2UY10_E1B19K-      TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
X4Y9D2_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
C5HDR2_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
M0QVC7_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
Q4KSL0_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
A0A1P7YYY5_E1B19K-      TSMLEEEIR---------EAMDKNP---------------RSGLDPPLEE
A0A1P8C849_E1B19K-      TSMLEEEMR---------EAMDKNP---------------RSGLDPPSEE
B9A5L5_E1B19K-01        TSMLEEEMR---------EAMDENP---------------RSGLDPPSEE
T1UGY3_E1B19K-01        TSMLEEEMR---------EAMDENP---------------RSGLDPPSEE
A0A1P7YWR9_E1B19K-      TSMLEEEMR---------EAMDKNP---------------RSGLDPPSEE
A0A1P7YWY2_E1B19K-      TSMLEEEMR---------ESMDKNP---------------RSGLDPPSEE
A0A1P7YXN8_E1B19K-      TSMLEEEMR---------EAMDKNP---------------RSGLDPPSEE
B9A5A7_E1B19K-01        TSMLEEEMR---------EAMDKNP---------------RSGLDPPSEE
T1UG22_E1B19K-01        TSMLEEEMR---------EAMDKNP---------------RSGLDPPSEE
H5T740_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
W8VNG2_E1B19K-01        TSMLEEEMR---------EAMDDNP---------------RSGLDPPSEE
F8UFP5_E1B19K-01        TSMLEEEMR---------EAMDDNP---------------RSGLDPPSEE
M0QV87_E1B19K-01        TSMLEEEMR---------EAMDENP---------------RSGLDPPSEE
M0QU02_E1B19K-01        TSMLEEEMR---------EAMDENP---------------RSGLDPPSEE
T1UKV6_E1B19K-01        TSMLEEEMR---------EAMDENP---------------RSGLDPPSEE
M0QV47_E1B19K-01        TSMLEEEMR---------ETMDENP---------------RSGLDPPSEE
M0QUW8_E1B19K-01        TSMLEEEMR---------EAMDENP---------------RSGLDPPSEE
E1CIJ0_E1B19K-01        TSMLEEEMR---------EAMDENP---------------RSGLDPPSEE
T1UGU0_E1B19K-01        TSMLEEEMR---------EAMDENP---------------RSGLDPPSEE
M0QVG6_E1B19K-01        TSMLEEEMR---------EAMDENP---------------RSGLDPPSEE
X4YVU5_E1B19K-01        TSMLEEEMR---------EAMDENP---------------RSGLDPPSEE
M0QUS9_E1B19K-01        TSMLEEEMR---------EAMDENP---------------RSGLDPPSEE
G1FBW4_E1B19K-01        TSMLEEEMR---------EAMDENP---------------RSGLDPPSEE
M0QVP5_E1B19K-01        TSMLEEEMR---------EAMDENP---------------RSGLDPPSEE
T1UKQ0_E1B19K-01        TSMLEEEMR---------EAMDENP---------------RSGLDPPSEE
W8CZB0_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
G1FC01_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
G3CK71_E1B19K-01        TSMLEEEMR---------QAMYENP---------------RSGLDPPSEE
T1UGT5_E1B19K-01        TSMLEEEMR---------EAMDENP---------------RSGLDPPSEE
T1UK99_E1B19K-01        TSMLEEEMR---------EAMDENP---------------RSGLDPPSEE
M0QTS5_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
M0QV08_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
G9JUV5_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
T1UGX3_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
T1ULJ8_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
T1UHG3_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
A0A1J0MS84_E1B19K-      TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
A0A097I4T0_E1B19K-      TSMLEEEMR---------QAMDENP---------------RSGLDPPPEE
E9P585_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPLEE
A0A1Y1BXT7_E1B19K-      TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
E5RWD9_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
M0QU76_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
T1UHL7_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
A0A075TSZ1_E1B19K-      TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
T1UHH6_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
T1UKP8_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
B9A5T7_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
D3GBW3_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
M0QUF3_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
E5RWL1_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
B6C6W8_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
M0QU41_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
F1DT57_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
B2VQE3_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
B9A681_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
A0A1Y1BYF1_E1B19K-      TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
B6DU90_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
T1UHZ2_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
A0A291B0H2_E1B19K-      TSMLEEEMR---------EAMDENP---------------RSGLDPPSEE
B9A5Q1_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
M0QUB4_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
M0QUJ3_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
M0QUN2_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
C4P207_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
E1CIM6_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
D4N3H6_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
M0QVK6_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
M0QVT4_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
E1AI10_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
H0PPE7_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
Q9YL99_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
K7ZLN6_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
E1CIR1_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
T1UHQ8_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
T1ULP4_E1B19K-01        TSMLEEEMR---------QAMDENP---------------RSGLDPPSEE
Q7T951_E1B19K-01        MPAVLEE-----------EQQEDNP---------------RAGLDPPVEE
T1UE63_E1B19K-01        MPAVLEE-----------EQQEDNP---------------RAGLDPPVEE
Q7T8D8_E1B19K-01        MPAVLEE-----------EQQEDNP---------------RAGLDPPVEE
Q8B8U7_E1B19K-01        MPAVLEE-----------EQQEDNP---------------RAGLDPPVEE
Q5UW22_E1B19K-01        MPAVLEE-----------EQQEDNP---------------RAGLDPPVEE
W6EIX6_E1B19K-01        MPAVLEE-----------EQQEDNP---------------RAGLDPPVEE
Q3ZL02_E1B19K-01        MPAVLEE-----------EQQEDNP---------------RAGLDPPVEE
A0A1L7NRH1_E1B19K-      MPAVLEE-----------EQQEDNP---------------RAGLDPPVEE
T1UFS4_E1B19K-01        MPAVLEE-----------EQQEDNP---------------RAGLDPPVEE
Q32UI6_E1B19K-01        MPAVLEE-----------EQQEDNP---------------RAGLDPPVEE
C7SRS7_E1B19K-01        MPAVLEE-----------EQQEDNP---------------RAGLDPPVEE
J7H4R9_E1B19K-01        MPAVLEE-----------EQQEDNP---------------RAGLDPPVEE
D2DM83_E1B19K-01        MPAVLEE-----------EQQEDNP---------------RAGLDPPVEE
J7I6W7_E1B19K-01        MPAVLEE-----------EQQEDNP---------------RAGLDPPVEE
T1UJX4_E1B19K-01        MPAVLEE-----------EQQEDNP---------------RAGLDPPVEE
T2CI10_E1B19K-01        MPAVLEE-----------EHQEDNP---------------RVGLDPPVEE
A0A0K0PX99_E1B19K-      MPAVLEE-----------EQQEDNP---------------RAGLDPPVEE
A0A0K0PX35_E1B19K-      MPSVLEE-----------EQQEDNP---------------RAGLDPPVEE
A0A220VZ73_E1B19K-      MPAVLQE-----------EQQEDNP---------------RAGLDPPVEE
R4HLE1_E1B19K-01        MPAVLQE-----------EQQEDNP---------------RAGLDPPVEE
R4HMC6_E1B19K-01        MPAVLQE-----------EQQEDNP---------------RAGLDPPVEE
I1V161_E1B19K-01        MPAVLQE-----------EQQEDNP---------------RAGLDPPVEE
P03248_E1B19K-02        MPAVLQE-----------EQQEDNP---------------RAGLDPPVEE
Q6RK98_E1B19K-01        MPAVLQE-----------EQQEDNP---------------RAGLDPPVEE
J7I6Q4_E1B19K-01        MPAVLQE-----------EQQEDNP---------------RAGLDPPVEE
J7I6S4_E1B19K-01        MPAVLQE-----------EQQEDNP---------------RAGLDPPVEE
R4HLJ6_E1B19K-01        MPAVLQE-----------EQQEDNP---------------RAGLDPPVEE
R4HLA0_E1B19K-01        MPAVLQE-----------EQQEDNP---------------RAGLDPPVEE
Q2KSL3_E1B19K-01        MPAVLQE-----------EQQEDNP---------------RAGLDPPVEE
Q2Y0J3_E1B19K-01        MPAVLQE-----------EQQEDNP---------------RAGLDPPVEE
Q5EY83_E1B19K-01        MPAVLQE-----------EQQEDNP---------------RAGLDPPVEE
I6LEP5_E1B19K-01        MPAVLQE-----------EQQEDNP---------------RAGLDPPVEE
I6LES1_E1B19K-01        MPAVLQE-----------EQQEDNP---------------RAGLDPPVEE
T1UF50_E1B19K-01        MPAVLQE-----------EQQEDNP---------------RAGLDPPVEE
J7ID56_E1B19K-01        MPAVLQE-----------EQQEDNP---------------RAGLDPPVEE
A0A0B4SJH1_E1B19K-      MPAVLEE-----------EQQEDNP---------------RAGLDPPVEE
A0A075IQ70_E1B19K-      MPAVLEE-----------EQQEDNP---------------RAGLDPPVEE
Q2KS85_E1B19K-01        MPAVLEE-----------EQQEDNP---------------RAGLDPPVEE
Q3ZKW2_E1B19K-01        MPAVLEE-----------EQQEDNP---------------RAGLDPPVEE
K7NG43_E1B19K-01        MPAVLEE-----------EQQEDNP---------------RAGLDPPVEE
Q2KRU2_E1B19K-01        MPAVLEE-----------EQQEDNP---------------RAGLDPPVEE
T1UIP3_E1B19K-01        MPAVLEE-----------EQQEDNP---------------RAGLDPPVEE
Q6QPF3_E1B19K-01        QEHQRRQQPQQEQQQ--EEDREENP---------------RAGLDPPVAE
Q6QPB7_E1B19K-01        QEHQRRQQPQQEQQQEEEEDREENP---------------RAGLDPPVAE
Q6QPI9_E1B19K-01        QEHQRRQQPQQEQQQ--EEDREENL---------------RAGLDPPVAE
P10406_E1B19K-01        --------------------------------------------------
Q5GFC7_E1B19K-01        --------------------------------------------------
A0A2R3WN62_E1B19K-      --------------------------------------------------
Q2KSM8_E1B19K-02        --------------------------------------------------
Q2KSG6_E1B19K-02        --------------------------------------------------
A0A2L1F392_E1B19K-      --------------------------------------------------
Q5GFC8_E1B19K-01        ------------QQQ---EDQEENP---------------RAGLDPPAEE
Q6H1D7_E1B19K-01        ------------QQQ---EDQEENP---------------RAGLDPPAEE
Q2KSG6_E1B19K-01        SQERQRR----QQQQ---EDQEENP---------------RAGLDPPAEE
Q2KSM8_E1B19K-01        SQERQRR----QQQQ---EDQEENP---------------RAGLDPPAEE
A0A2R3WN16_E1B19K-      SQERQRR----QQQQ---EDQEENP---------------RAGLDPPAEE
A0A2L1F3A2_E1B19K-      SQERQRR----QQQQ---EDQEENP---------------RAGLDPPAEE
G9G841_E1B19K-01        PRARQRRRQQQRQQE---EDQEENP---------------RAGLDPPAEE
Q8UY91_E1B19K-01        PRARQRR--QQQQQE---EDQEENP---------------RAGLDPPAEE
                                                                          

Q71BY5_E1B19K-01        ----------
A0A0M4NHE0_E1B19K-      D---------
H9AAK5_E1B19K-01        N---------
G0ZAH2_E1B19K-01        QWEADHDPEA
A0A1W5PVU4_E1B19K-      ----------
A0A0M3TH18_E1B19K-      ----------
A0A097IW62_E1B19K-      ----------
A0A0A1EUE4_E1B19K-      ----------
A0A2H5AI40_E1B19K-      ----------
A0A2H5AID8_E1B19K-      ----------
A0A2H5AII9_E1B19K-      ----------
A0A2H5AIL0_E1B19K-      ----------
A0A2H5AIN5_E1B19K-      ----------
A0A2H5AIS9_E1B19K-      ----------
A0A2H5AIT6_E1B19K-      ----------
A0A2H5AIU0_E1B19K-      ----------
A0A2H5AIC5_E1B19K-      ----------
D3JIR7_E1B19K-01        ----------
A0A076V686_E1B19K-      ----------
P04492_E1B19K-01        ----------
G1DE13_E1B19K-01        ----------
D0Z5R9_E1B19K-01        ----------
T1UEX7_E1B19K-01        ----------
A0A2H5AI99_E1B19K-      ----------
A0A0M3TH31_E1B19K-      ----------
M9YXY5_E1B19K-01        ----------
M9YVF6_E1B19K-01        ----------
A0MK43_E1B19K-01        ----------
A0A2H5AI21_E1B19K-      ----------
A0A0M5L3Y4_E1B19K-      ----------
Q5C8R2_E1B19K-01        ----------
A0A0A1EUB2_E1B19K-      ----------
A0A0A1EUC8_E1B19K-      ----------
A0A2H5AI04_E1B19K-      ----------
A0A2H5AI72_E1B19K-      ----------
A0A2H5AIL3_E1B19K-      ----------
A0A2H4CJZ0_E1B19K-      ----------
H8PFZ1_E1B19K-01        ----------
F4ZCJ8_E1B19K-01        ----------
A0A1S6ELT2_E1B19K-      ----------
B5SNR1_E1B19K-01        ----------
P10544_E1B19K-01        ----------
W0S1G8_E1B19K-01        ----------
A0A142G3J2_E1B19K-      ----------
P10543_E1B19K-01        ----------
Q71BY5_E1B19K-02        ----------
E1ARN8_E1B19K-01        ----------
A0A2H4PJ75_E1B19K-      ----------
P03246_E1B19K-01        ----------
Q6VGV8_E1B19K-01        ----------
A0A0G2R248_E1B19K-      ----------
Q6WQ37_E1B19K-01        ----------
A0A291P1B2_E1B19K-      ----------
T1UG63_E1B19K-01        ----------
A0A1U9ALK7_E1B19K-      ----------
P03247_E1B19K-01        ----------
J9Z5H0_E1B19K-01        ----------
J7I6T8_E1B19K-01        ----------
J9Z4H6_E1B19K-01        ----------
J9Z4N4_E1B19K-01        ----------
P06501_E1B19K-01        N---------
A0A0M4N3Z1_E1B19K-      N---------
Q8B6X5_E1B19K-01        N---------
H9AAD9_E1B19K-01        N---------
H9AAH3_E1B19K-01        N---------
H9AAA8_E1B19K-01        N---------
M9YVA3_E1B19K-01        N---------
F2WTJ7_E1B19K-01        KED-------
F2WTM9_E1B19K-01        KED-------
H9AA76_E1B19K-01        N---------
A0A1C8EG46_E1B19K-      N---------
H9AAN8_E1B19K-01        N---------
H9AAS0_E1B19K-01        N---------
H9AAV3_E1B19K-01        N---------
H9AAY5_E1B19K-01        N---------
A0A1L3INW0_E1B19K-      EVD-------
F6KST6_E1B19K-01        A---------
F2WTG5_E1B19K-01        E---------
Q695T5_E1B19K-01        E---------
H9TER0_E1B19K-01        E---------
A0A0G2UY10_E1B19K-      ELD-------
X4Y9D2_E1B19K-01        ELD-------
C5HDR2_E1B19K-01        ELD-------
M0QVC7_E1B19K-01        ELD-------
Q4KSL0_E1B19K-01        ELD-------
A0A1P7YYY5_E1B19K-      ELD-------
A0A1P8C849_E1B19K-      ELD-------
B9A5L5_E1B19K-01        ELD-------
T1UGY3_E1B19K-01        ELD-------
A0A1P7YWR9_E1B19K-      ELD-------
A0A1P7YWY2_E1B19K-      ELD-------
A0A1P7YXN8_E1B19K-      ELD-------
B9A5A7_E1B19K-01        ELD-------
T1UG22_E1B19K-01        ELD-------
H5T740_E1B19K-01        ELD-------
W8VNG2_E1B19K-01        ELD-------
F8UFP5_E1B19K-01        ELD-------
M0QV87_E1B19K-01        ELD-------
M0QU02_E1B19K-01        ELD-------
T1UKV6_E1B19K-01        ELD-------
M0QV47_E1B19K-01        ELD-------
M0QUW8_E1B19K-01        ELD-------
E1CIJ0_E1B19K-01        ELD-------
T1UGU0_E1B19K-01        ELD-------
M0QVG6_E1B19K-01        ELD-------
X4YVU5_E1B19K-01        ELD-------
M0QUS9_E1B19K-01        ELD-------
G1FBW4_E1B19K-01        ELD-------
M0QVP5_E1B19K-01        ELD-------
T1UKQ0_E1B19K-01        ELD-------
W8CZB0_E1B19K-01        ELD-------
G1FC01_E1B19K-01        ELD-------
G3CK71_E1B19K-01        ELD-------
T1UGT5_E1B19K-01        ELD-------
T1UK99_E1B19K-01        ELD-------
M0QTS5_E1B19K-01        ELD-------
M0QV08_E1B19K-01        ELD-------
G9JUV5_E1B19K-01        ELD-------
T1UGX3_E1B19K-01        ELD-------
T1ULJ8_E1B19K-01        ELD-------
T1UHG3_E1B19K-01        ELD-------
A0A1J0MS84_E1B19K-      ELD-------
A0A097I4T0_E1B19K-      ELD-------
E9P585_E1B19K-01        ELD-------
A0A1Y1BXT7_E1B19K-      ELD-------
E5RWD9_E1B19K-01        ELD-------
M0QU76_E1B19K-01        ELD-------
T1UHL7_E1B19K-01        ELD-------
A0A075TSZ1_E1B19K-      ELD-------
T1UHH6_E1B19K-01        ELD-------
T1UKP8_E1B19K-01        ELD-------
B9A5T7_E1B19K-01        ELN-------
D3GBW3_E1B19K-01        ELD-------
M0QUF3_E1B19K-01        ELD-------
E5RWL1_E1B19K-01        ELD-------
B6C6W8_E1B19K-01        ELN-------
M0QU41_E1B19K-01        ELD-------
F1DT57_E1B19K-01        ELD-------
B2VQE3_E1B19K-01        ELD-------
B9A681_E1B19K-01        ELN-------
A0A1Y1BYF1_E1B19K-      ELN-------
B6DU90_E1B19K-01        ELD-------
T1UHZ2_E1B19K-01        ELN-------
A0A291B0H2_E1B19K-      ELD-------
B9A5Q1_E1B19K-01        ELD-------
M0QUB4_E1B19K-01        ELD-------
M0QUJ3_E1B19K-01        ELD-------
M0QUN2_E1B19K-01        ELD-------
C4P207_E1B19K-01        ELD-------
E1CIM6_E1B19K-01        ELD-------
D4N3H6_E1B19K-01        ELD-------
M0QVK6_E1B19K-01        ELD-------
M0QVT4_E1B19K-01        ELD-------
E1AI10_E1B19K-01        ELD-------
H0PPE7_E1B19K-01        ELD-------
Q9YL99_E1B19K-01        ELD-------
K7ZLN6_E1B19K-01        ELD-------
E1CIR1_E1B19K-01        ELD-------
T1UHQ8_E1B19K-01        ELD-------
T1ULP4_E1B19K-01        ELD-------
Q7T951_E1B19K-01        AE--------
T1UE63_E1B19K-01        AE--------
Q7T8D8_E1B19K-01        AE--------
Q8B8U7_E1B19K-01        AE--------
Q5UW22_E1B19K-01        AE--------
W6EIX6_E1B19K-01        AE--------
Q3ZL02_E1B19K-01        AE--------
A0A1L7NRH1_E1B19K-      AE--------
T1UFS4_E1B19K-01        AE--------
Q32UI6_E1B19K-01        AE--------
C7SRS7_E1B19K-01        AE--------
J7H4R9_E1B19K-01        AE--------
D2DM83_E1B19K-01        AE--------
J7I6W7_E1B19K-01        AE--------
T1UJX4_E1B19K-01        AE--------
T2CI10_E1B19K-01        AEE-------
A0A0K0PX99_E1B19K-      AEE-------
A0A0K0PX35_E1B19K-      AEE-------
A0A220VZ73_E1B19K-      ----------
R4HLE1_E1B19K-01        ----------
R4HMC6_E1B19K-01        ----------
I1V161_E1B19K-01        ----------
P03248_E1B19K-02        ----------
Q6RK98_E1B19K-01        ----------
J7I6Q4_E1B19K-01        ----------
J7I6S4_E1B19K-01        ----------
R4HLJ6_E1B19K-01        ----------
R4HLA0_E1B19K-01        ----------
Q2KSL3_E1B19K-01        ----------
Q2Y0J3_E1B19K-01        ----------
Q5EY83_E1B19K-01        ----------
I6LEP5_E1B19K-01        ----------
I6LES1_E1B19K-01        ----------
T1UF50_E1B19K-01        ----------
J7ID56_E1B19K-01        ----------
A0A0B4SJH1_E1B19K-      ----------
A0A075IQ70_E1B19K-      ----------
Q2KS85_E1B19K-01        ----------
Q3ZKW2_E1B19K-01        ----------
K7NG43_E1B19K-01        ----------
Q2KRU2_E1B19K-01        ----------
T1UIP3_E1B19K-01        ----------
Q6QPF3_E1B19K-01        EEE-------
Q6QPB7_E1B19K-01        EEE-------
Q6QPI9_E1B19K-01        EEE-------
P10406_E1B19K-01        ----------
Q5GFC7_E1B19K-01        ----------
A0A2R3WN62_E1B19K-      ----------
Q2KSM8_E1B19K-02        ----------
Q2KSG6_E1B19K-02        ----------
A0A2L1F392_E1B19K-      ----------
Q5GFC8_E1B19K-01        ----------
Q6H1D7_E1B19K-01        ----------
Q2KSG6_E1B19K-01        E---------
Q2KSM8_E1B19K-01        EE--------
A0A2R3WN16_E1B19K-      EE--------
A0A2L1F3A2_E1B19K-      E---------
G9G841_E1B19K-01        E---------
Q8UY91_E1B19K-01        EE--------
                                  

© 1998-2018