Dataset for protein adenoviridae of organism all

[Download (right click)] [Edit] [Sequences] [Repertoires]

243 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q71BY5_E1B19K-01        -------------------------------------------------M
A0A0M4NHE0_E1B19K-      MINCCELWLFIQRVLPGRYKGSGFQARGIYPLAAF--MDLRAELQTFEST
H9AAK5_E1B19K-01        MINGCELWLFIQRGLPGRYKGSGFQARGIYPLAAF--MDLRAELQTFEST
G0ZAH2_E1B19K-01        -------------------------------------MDLLKFLEDFENC
A0A3Q9HK00_E1B19K-      --------MFNLHGVLNGAGLKGYIMRRGLILVTFDLMEAWECLEDFSAV
A0A3Q9HK78_E1B19K-      --------MFNLHGVLNGAGLKGYIMRRGLILVTFDLMEAWECLEDFSAV
A0A3S9SPV1_E1B19K-      --------MFNLHGVLNGAGLKGYIMRRGLILVTFDLMEAWECLEDFSAV
A0A1W5PVU4_E1B19K-      --------------------------MMKRPVAAEVQMELDRLLENYNSL
A0A0M3TH18_E1B19K-      ---------------------------MKRPVAAEVQMELDRLLENYNSL
A0A097IW62_E1B19K-      -------------------------------------MDLDRVLENYNSL
A0A0A1EUE4_E1B19K-      ----------------------------MGSESTSALMDLLGNLREFDVV
A0A2H5AI40_E1B19K-      ----------------------------MGSESTAALMDLLGNLREFDVV
A0A2H5AID8_E1B19K-      ----------------------------MGSESTAALMDLLGNLREFDVV
A0A2H5AII9_E1B19K-      ----------------------------MGSESTAALMDLLGNLREFDVV
A0A2H5AIL0_E1B19K-      ----------------------------MGSESTAALMDLLGNLREFDVV
A0A2H5AIN5_E1B19K-      ----------------------------MGSESTAALMDLLGNLREFDVV
A0A2H5AIS9_E1B19K-      ----------------------------MGSESTAALMDLLGNLREFDVV
A0A2H5AIT6_E1B19K-      ----------------------------MGSESTAALMDLLGNLREFDVV
A0A2H5AIU0_E1B19K-      ----------------------------MGSESTAALMDLLGNLREFDVV
A0A2H5AIC5_E1B19K-      ----------------------------MGSESTAALMDLLGNLREFDVV
D3JIR7_E1B19K-01        -------------------------------------MELEAVLQSYQGV
A0A076V686_E1B19K-      -------------------------------------MELEAVLQSYQSI
G1DE13_E1B19K-01        -------------------------------------MELEAVLQSFQSV
D0Z5R9_E1B19K-01        -------------------------------------MELEAVLQSFQSV
T1UEX7_E1B19K-01        -------------------------------------MELEAVLQSFQSV
A0A3G8WH01_E1B19K-      -------------------------------------MELETVLQSFQSV
P04492_E1B19K-01        -------------------------------------MELETVLQSFQSV
A0A2H5AI99_E1B19K-      -------------------------------------MDLLKELRDFDVV
A0A0M3TH31_E1B19K-      -------------------------------------MDLLRLLSDYEVL
M9YXY5_E1B19K-01        -------------------------------------MDLLRLLSDYEVL
M9YVF6_E1B19K-01        -------------------------------------MDLLRLLSDYEVL
A0MK43_E1B19K-01        -------------------------------------MDLLGNLREFDVV
A0A2H5AI21_E1B19K-      -------------------------------------MDLLGDLREFGVV
A0A0M5L3Y4_E1B19K-      -------------------------------------MDLLGDLREFGVV
Q5C8R2_E1B19K-01        -------------------------------------MDLLGDLREFGVV
A0A0A1EUB2_E1B19K-      -------------------------------------MDLLGDLREFGVV
A0A0A1EUC8_E1B19K-      -------------------------------------MDLLGDLREFGVV
A0A2H5AI04_E1B19K-      -------------------------------------MDLLGDLREFGVV
A0A2H5AI72_E1B19K-      -------------------------------------MDLLGDLREFGVV
A0A2H5AIL3_E1B19K-      -------------------------------------MDLLGDLREFGVV
A0A2H4CJZ0_E1B19K-      -------------------------------------MEFWSELQNYQSL
H8PFZ1_E1B19K-01        -------------------------------------MEYWSELQNYQSL
A0A1S6ELT2_E1B19K-      -------------------------------------MEFWSELQSYQSL
A0A3G4W995_E1B19K-      -------------------------------------MEFWSELQSYQSL
B5SNR1_E1B19K-01        -------------------------------------MEFWSELQSYQSL
P10544_E1B19K-01        -------------------------------------MEFWSELQSYQSL
W0S1G8_E1B19K-01        -------------------------------------MEFWSELQSYQSL
A0A3G8W407_E1B19K-      -------------------------------------MEFWSELQSYQSL
F4ZCJ8_E1B19K-01        -------------------------------------MEFWSELQSYQSL
A0A142G3J2_E1B19K-      -------------------------------------MELWSELQSYQNL
P10543_E1B19K-01        -------------------------------------MELWSELQSYQNL
A0A3S9SNH4_E1B19K-      -------------------------------------MEAWECLEDFSAV
A0A3S9SSS2_E1B19K-      -------------------------------------MEAWECLEDFSAV
A0A3S9SNY0_E1B19K-      -------------------------------------MEAWECLEDFSAV
Q71BY5_E1B19K-02        -------------------------------------MEAWECLEDFSAV
A0A3Q9HJ63_E1B19K-      -------------------------------------MEAWECLEDFSAV
A0A3Q9HLF7_E1B19K-      -------------------------------------MEAWECLEDFSAV
E1ARN8_E1B19K-01        -------------------------------------MEAWECLEDFSAV
A0A2H4PJ75_E1B19K-      -------------------------------------MEAWECLEDFSAV
Q6WQ37_E1B19K-01        -------------------------------------MEAWECLEDFSAV
P03246_E1B19K-01        -------------------------------------MEAWECLEDFSAV
Q6VGV8_E1B19K-01        -------------------------------------MEAWECLEDFSAV
A0A0G2R248_E1B19K-      -------------------------------------MEAWECLEDFSAV
A0A3Q9HJ54_E1B19K-      -------------------------------------MEAWECLEDFSAV
A0A3S9SND6_E1B19K-      -------------------------------------MEAWECLEDFSAV
A0A3S9SP19_E1B19K-      -------------------------------------MEAWECLEDFSAV
A0A291P1B2_E1B19K-      -------------------------------------METWECLEDFSAV
T1UG63_E1B19K-01        -------------------------------------MEAWECLEDFSAV
A0A1U9ALK7_E1B19K-      -------------------------------------MEAWECLEDFSAV
P03247_E1B19K-01        -------------------------------------MEAWECLEDFSAV
A0A3G8W3H5_E1B19K-      -------------------------------------MEAWECLEDFSAV
J9Z5H0_E1B19K-01        -------------------------------------MEAWECLEDFSAV
J9Z4N4_E1B19K-01        -------------------------------------MEAWECLEDFSAV
A0A3Q9HJZ5_E1B19K-      -------------------------------------MEAWECLEDFSAV
J7I6T8_E1B19K-01        -------------------------------------MEAWECLEDFSAV
J9Z4H6_E1B19K-01        -------------------------------------MEAWECLEDFSAV
P06501_E1B19K-01        -------------------------------------MDLRTALQTFEST
A0A0M4N3Z1_E1B19K-      -------------------------------------MDLRTALQTFEST
Q8B6X5_E1B19K-01        -------------------------------------MDLRTALQTFEST
H9AAD9_E1B19K-01        -------------------------------------MDLRAELQTFEST
H9AAH3_E1B19K-01        -------------------------------------MDLRAELQTFEST
H9AAA8_E1B19K-01        -------------------------------------MDLRVELQTFEST
M9YVA3_E1B19K-01        -------------------------------------MDLRVELQTFEST
F2WTJ7_E1B19K-01        -------MINDVNFVCLFKGDYLGGIKGAAVGLGHFTMDLRVELQTFEST
F2WTM9_E1B19K-01        -------MINDVNFVCLFKGDYLGGIKGAAVGLGHFTMNLRVELQTFEST
H9AA76_E1B19K-01        -------MINDVNFVCLFKGDYLGGIKGVVVRLGHFTMDLRVELQTFEST
A0A1C8EG46_E1B19K-      -------MINDVNFVCLFKGDYLGGIKGAVVRLGHFTMDLRVELQTFEST
H9AAN8_E1B19K-01        -------MINDVNFVCLFKGDYLGGIKGAVVRLGHFTMDLRVELQTFEST
H9AAS0_E1B19K-01        -------MINDVNFVCLFKGDYLGGIKGAVVRLGHFTMDLRVELQTFEST
H9AAV3_E1B19K-01        -------MINDVNFVCLFKGDYLGGIKGAVVRLGHFTMDLRVELQTFEST
H9AAY5_E1B19K-01        -------MINDVNFVCLFKGDYLGGIKGAVVRLGHFTMDLRVELQTFEST
A0A1L3INW0_E1B19K-      -------------------------------------MDLYKSLEDRSTL
F6KST6_E1B19K-01        -------------------------------------MDLYESLENLGSL
F2WTG5_E1B19K-01        -------------------------------------MDLYESLENLSSL
Q695T5_E1B19K-01        -------------------------------------MDLYESLENLSSL
H9TER0_E1B19K-01        -------------------------------------MDLYESLENLSSL
A0A0G2UY10_E1B19K-      -----------MTHGRGLVLYKWQHLGTWAQTFREFLMDVWTILADFSKT
X4Y9D2_E1B19K-01        -----------MTHGRGLVLYKWQHLGTRAQTFREFLMDVWTILADFSKT
C5HDR2_E1B19K-01        -----------MTHGRGLVLYKWQHLGTWAQTFREFLMDVWTILADFSKT
M0QVC7_E1B19K-01        -----------MTHGRGLVLYKWQHLGTGAQTFRKFLMDVWTILADFSKT
A0A3S6PYX7_E1B19K-      -----------MTHGRGLVLYKWQHLGTWAQTFREFLMDVWTILADFSKT
Q4KSL0_E1B19K-01        -----------MTHGRGLVLYKWQHLGTGAQTFREFLMDVWTILADFSKT
A0A1P7YYY5_E1B19K-      -------------------------------------MDVWSILGEFNKT
A0A1P8C849_E1B19K-      -------------------------------------MDVWSILGEFNKT
B9A5L5_E1B19K-01        -------------------------------------MDVWSILGEFNKT
T1UGY3_E1B19K-01        -------------------------------------MDVWSILGEFNKT
A0A1P7YWR9_E1B19K-      -------------------------------------MDVWSILGEFNKT
A0A1P7YWY2_E1B19K-      -------------------------------------MDVWSILGEFNKT
A0A1P7YXN8_E1B19K-      -------------------------------------MDVWSILGEFNKT
B9A5A7_E1B19K-01        -------------------------------------MDVWSILGEFNKT
T1UG22_E1B19K-01        -------------------------------------MDVWSILGEFNKT
H5T740_E1B19K-01        -------------------------------------MEVWTILADFNKT
A0A1J0MS84_E1B19K-      -------------------------------------MDVWTILADFSKT
A0A097I4T0_E1B19K-      -------------------------------------MDVWTILADFSKT
E5RWD9_E1B19K-01        -------------------------------------MDVWTILADFSKT
M0QU76_E1B19K-01        -------------------------------------MDVWTILADFSKT
B9A5T7_E1B19K-01        -------------------------------------MDVWTILADFSKT
D3GBW3_E1B19K-01        -------------------------------------MDVWTILADFSKT
M0QUF3_E1B19K-01        -------------------------------------MDVWTILADFSKT
E5RWL1_E1B19K-01        -------------------------------------MDVWTILADFSKT
B6C6W8_E1B19K-01        -------------------------------------MDVWTILADFSKT
M0QU41_E1B19K-01        -------------------------------------MDVWTILADFSKT
F1DT57_E1B19K-01        -------------------------------------MDVWTILADFSKT
B2VQE3_E1B19K-01        -------------------------------------MDVWTILADFSKT
B9A681_E1B19K-01        -------------------------------------MDVWTILADFSKT
A0A1Y1BYF1_E1B19K-      -------------------------------------MDVWTILADFSKT
B6DU90_E1B19K-01        -------------------------------------MDVWTILADFSKT
T1UHZ2_E1B19K-01        -------------------------------------MDVWTILADFSKT
A0A3Q9FFS0_E1B19K-      -------------------------------------MDVWSILADFSKT
T1ULJ8_E1B19K-01        -------------------------------------MDVWTILADFSKT
T1UHG3_E1B19K-01        -------------------------------------MDVWTILADFSKT
E9P585_E1B19K-01        -------------------------------------MDVWTILADFSKT
A0A1Y1BXT7_E1B19K-      -------------------------------------MDVWTILADFSKT
T1UHL7_E1B19K-01        -------------------------------------MDVWTILADFSKT
A0A075TSZ1_E1B19K-      -------------------------------------MDVWTILADFSKT
T1UHH6_E1B19K-01        -------------------------------------MDVWTILADFSKT
T1UKP8_E1B19K-01        -------------------------------------MDVWTILADFSKT
B9A5Q1_E1B19K-01        -------------------------------------MDVWTILADFSKT
M0QUB4_E1B19K-01        -------------------------------------MDVWTILADFSKT
M0QUJ3_E1B19K-01        -------------------------------------MDVWTILADFSKT
M0QUN2_E1B19K-01        -------------------------------------MDVWTILADFSKT
C4P207_E1B19K-01        -------------------------------------MDVWTILADFSKT
E1CIM6_E1B19K-01        -------------------------------------MDVWTILADFSKT
D4N3H6_E1B19K-01        -------------------------------------MDVWTILADFSKT
M0QVK6_E1B19K-01        -------------------------------------MDVWTILADFSKT
M0QVT4_E1B19K-01        -------------------------------------MDVWTILADFSKT
E1AI10_E1B19K-01        -------------------------------------MDVWTILADFSKT
H0PPE7_E1B19K-01        -------------------------------------MDVWTILADFSKT
A0A3G8WIY5_E1B19K-      -------------------------------------MDVWTILADFSKT
Q9YL99_E1B19K-01        -------------------------------------MDVWTILADFSKT
K7ZLN6_E1B19K-01        -------------------------------------MDVWTILADFSKT
A0A384ZUF2_E1B19K-      -------------------------------------MDVWTILADFSKT
A0A384ZUM9_E1B19K-      -------------------------------------MDVWTILADFSKT
E1CIR1_E1B19K-01        -------------------------------------MDVWTILADFSKT
T1UHQ8_E1B19K-01        -------------------------------------MDVWTILADFSKT
T1ULP4_E1B19K-01        -------------------------------------MDVWTILADFSKT
A0A291B0H2_E1B19K-      -------------------------------------MDVWTILGDFSKT
W8VNG2_E1B19K-01        -------------------------------------MEVWTILGDFNKT
F8UFP5_E1B19K-01        -------------------------------------MEVWTILADFNKT
M0QV87_E1B19K-01        -------------------------------------MDVWTILGDFVKT
M0QU02_E1B19K-01        -------------------------------------MDVWTILADFNKT
T1UKV6_E1B19K-01        -------------------------------------MDVWTILGDFNKT
M0QV47_E1B19K-01        -------------------------------------MEVWTILADFNKT
M0QUW8_E1B19K-01        -------------------------------------MEVWTILADFNKT
E1CIJ0_E1B19K-01        -------------------------------------MEVWTILADFNKT
T1UGU0_E1B19K-01        -------------------------------------MEVWTILADFNKT
M0QVG6_E1B19K-01        -------------------------------------MEVWTILADFSKT
X4YVU5_E1B19K-01        -------------------------------------MEVWTILADFSKT
M0QUS9_E1B19K-01        -------------------------------------MEVWTILADFNKT
G1FBW4_E1B19K-01        -------------------------------------MEVWTILADFNKT
M0QVP5_E1B19K-01        -------------------------------------MDVWTILADFNKT
T1UKQ0_E1B19K-01        -------------------------------------MDVWTILADFNKT
W8CZB0_E1B19K-01        -------------------------------------MEVWTILGDFNKT
G1FC01_E1B19K-01        -------------------------------------MEVWTILGDFNKT
G3CK71_E1B19K-01        -------------------------------------MEVWTILGDFNKT
T1UGT5_E1B19K-01        -------------------------------------MEVWTILADFNKT
T1UK99_E1B19K-01        -------------------------------------MEVWTILGDFNKT
M0QTS5_E1B19K-01        -------------------------------------MEVWTILADFSKT
M0QV08_E1B19K-01        -------------------------------------MEVWTILADFSKT
G9JUV5_E1B19K-01        -------------------------------------MEVWTILADFSKT
T1UGX3_E1B19K-01        -------------------------------------MDVWTILADFSQT
Q7T951_E1B19K-01        -------------------------------------MEVWAILEDLRKT
T1UE63_E1B19K-01        -------------------------------------MEVWAILEDLRKT
Q7T8D8_E1B19K-01        -------------------------------------MEVWAILEDLRKT
Q8B8U7_E1B19K-01        -------------------------------------MEVWAILEDLRKT
Q5UW22_E1B19K-01        -------------------------------------MEVWAILEDLRKT
W6EIX6_E1B19K-01        -------------------------------------MEVWAILEDLRKT
Q3ZL02_E1B19K-01        -------------------------------------MEVWAILEDLRKT
A0A1L7NRH1_E1B19K-      -------------------------------------MEVWAILEDLRKT
T1UFS4_E1B19K-01        -------------------------------------MEVWAILEDLRKT
Q32UI6_E1B19K-01        -------------------------------------MEVWAILEDLRKT
C7SRS7_E1B19K-01        -------------------------------------MEVWAILEDLRKT
J7H4R9_E1B19K-01        -------------------------------------MEVWAILEDLRKT
D2DM83_E1B19K-01        -------------------------------------MEVWAILEDLRKT
J7I6W7_E1B19K-01        -------------------------------------MEVWAILEDLRKT
T1UJX4_E1B19K-01        -------------------------------------MEVWAILEDLRKT
T2CI10_E1B19K-01        -------------------------------------MEVWAILEDLRQT
A0A0K0PX99_E1B19K-      -------------------------------------MEVWAILEDLRQT
A0A0K0PX35_E1B19K-      -------------------------------------MEVWAILEDLRQT
A0A220VZ73_E1B19K-      -------------------------------------MEVWAILEDLRQT
R4HLE1_E1B19K-01        -------------------------------------MEVWAILEDLRQT
R4HMC6_E1B19K-01        -------------------------------------MEVWAILEDLRQT
I1V161_E1B19K-01        -------------------------------------MEVWAILEDLRQT
P03248_E1B19K-02        -------------------------------------MEVWAILEDLRQT
Q6RK98_E1B19K-01        -------------------------------------MEVWAILEDLRQT
J7I6Q4_E1B19K-01        -------------------------------------MEVWAILEDLRQT
J7I6S4_E1B19K-01        -------------------------------------MEVWAILEDLRQT
R4HLJ6_E1B19K-01        -------------------------------------MEVWAILEDLRQT
R4HLA0_E1B19K-01        -------------------------------------MEVWAILEDLRQT
Q2KSL3_E1B19K-01        -------------------------------------MEVWAILEDLRQT
Q2Y0J3_E1B19K-01        -------------------------------------MEVWAILEDLRQT
Q5EY83_E1B19K-01        -------------------------------------MEVWAILEDLRQT
I6LEP5_E1B19K-01        -------------------------------------MEVWAILEDLRQT
I6LES1_E1B19K-01        -------------------------------------MEVWAILEDLRQT
T1UF50_E1B19K-01        -------------------------------------MKVWAILEDLRQT
J7ID56_E1B19K-01        -------------------------------------MEVWAILEDLKQT
A0A0B4SJH1_E1B19K-      -------------------------------------MEVWAILEDLKQT
A0A075IQ70_E1B19K-      -------------------------------------MEVWAILEDLKQT
Q2KS85_E1B19K-01        -------------------------------------MEVWAILEDLRQT
Q3ZKW2_E1B19K-01        -------------------------------------MEVWAILEDLRQT
K7NG43_E1B19K-01        -------------------------------------MEVWAILEDLRQT
Q2KRU2_E1B19K-01        -------------------------------------MEVWAILEDLRQT
T1UIP3_E1B19K-01        -------------------------------------MEVWAILEDLRQT
Q6QPF3_E1B19K-01        -------------------------------------MEIWTVLEDFHQT
Q6QPB7_E1B19K-01        -------------------------------------MEIWTVLEDFHQT
Q6QPI9_E1B19K-01        -------------------------------------MEIWTVLEDFHQT
P10406_E1B19K-01        -------------------------------------MEIWTVLEDFHKT
Q5GFC7_E1B19K-01        -------------------------------------MEIWTVLEDFHKT
A0A2R3WN62_E1B19K-      -------------------------------------MEIWTVLEDFHKT
A0A3G9JTX5_E1B19K-      -------------------------------------MEIWTVLEDFYKT
Q2KSM8_E1B19K-02        -------------------------------------MEIWTVLEDFYKT
A0A2R3WNP3_E1B19K-      -------------------------------------MEIWTVLEDFYKT
Q2KSG6_E1B19K-02        -------------------------------------MEIWTVLEDFYKT
A0A2L1F392_E1B19K-      -------------------------------------MEIWTVLEDFYKT
A0A3G9CMQ4_E1B19K-      -------------------------------------MEIWTVLEDFHKT
Q5GFC8_E1B19K-01        -------------------------------------MEIWTVLEDFHKT
Q6H1D7_E1B19K-01        -------------------------------------MEIWTVLEDFHKT
A0A3G8W6L2_E1B19K-      -------------------------------------MEIWTVLEDFYKT
Q2KSG6_E1B19K-01        -------------------------------------MEIWTVLEDFYKT
Q2KSM8_E1B19K-01        -------------------------------------MEIWTVLEDFYKT
A0A2R3WN16_E1B19K-      -------------------------------------MEIWTVLEDFYKT
G9G841_E1B19K-01        -------------------------------------MEIWTILEDLHKT
Q8UY91_E1B19K-01        -------------------------------------MEIWTVLEDFHKT
                                                                          

Q71BY5_E1B19K-01        RHIICHGGVITEEMAASLLDQLIEEVLC-LNLSLSPSQNRNLQDLPG---
A0A0M4NHE0_E1B19K-      RRLVELCSNRSSWFGRFLFGSTLCRVVRQVKEEYQSEFEHILSNCPG-LF
H9AAK5_E1B19K-01        RRLVELCSNRSSWFGRFLFGSTLCRVVRQVKEEYQSEFEHILSNCPG-LF
G0ZAH2_E1B19K-01        RQVLQQASKRTGGWSRWLLGNQLVRTVAQVKTDYSEHFEQLLQEQNRLLL
A0A3Q9HK00_E1B19K-      RNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGE-LF
A0A3Q9HK78_E1B19K-      RNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGE-LF
A0A3S9SPV1_E1B19K-      RNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGE-LF
A0A1W5PVU4_E1B19K-      RRVLEEASEDTSVWWRRLFGCRVSQLVVQAKVEYKEEFEKLFSEVPG-LV
A0A0M3TH18_E1B19K-      RRVLEEASEDTSVWWRKLFGCRVSQLVVQAKVEYKEEFEKLFSEVPG-LV
A0A097IW62_E1B19K-      RKVVEEASEQTSGWWRKLFGCRLSCLVVQAKFEYREEFERLFAEVPG-LL
A0A0A1EUE4_E1B19K-      RRLLELASDKTSRLWRFWFGSTLSSVVYRVKKEQEGQFSRLLADIPG-VF
A0A2H5AI40_E1B19K-      RRLLELASDKTSRLWRFWFGSTLSSVVYRVKREQEAQFARLLAETPG-VL
A0A2H5AID8_E1B19K-      RRLLELASDKTSRLWRFWFGSTLSSVVYRVKREQEAQFARLLAETPG-VL
A0A2H5AII9_E1B19K-      RRLLELASDKTSRLWRFWFGSTLSSVVYRVKREQEAQFARLLAETPG-VL
A0A2H5AIL0_E1B19K-      RRLLELASDKTSRLWRFWFGSTLSSVVYRVKREQEAQFARLLAETPG-VL
A0A2H5AIN5_E1B19K-      RRLLELASDKTSRLWRFWFGSTLSSVVYRVKREQEAQFARLLAETPG-VL
A0A2H5AIS9_E1B19K-      RRLLELASDKTSRLWRFWFGSTLSSVVYRVKREQEAQFARLLAETPG-VL
A0A2H5AIT6_E1B19K-      RRLLELASDKTSRLWRFWFGSTLSSVVYRVKREQEAQFARLLAETPG-VL
A0A2H5AIU0_E1B19K-      RRLLELASDKTSRLWRFWFGSTLSSVVYRVKREQEAQFARLLAETPG-VL
A0A2H5AIC5_E1B19K-      RRLLELASDKTSRLWRFWFGSTLSSVVYRVKREQEAQFARLLAETPG-VL
D3JIR7_E1B19K-01        RQLLQYTSKNTSGFWRYLFGSTLCKVVHRVKEDYRKEFENILAGCPG-LL
A0A076V686_E1B19K-      RQLLQHTSRNTSGFWRYLFGSTLSKVVHRVKEDYRNEFENILAGCPG-LL
G1DE13_E1B19K-01        RQLLQYTSKNTSGFWRYLFGSTFSKVVHRVKEDYREEFENILTDCPG-LL
D0Z5R9_E1B19K-01        RQLLQYTSKNTSGFWRYLFGSTLSKVVHRVKEDYREEFENILADCPG-LL
T1UEX7_E1B19K-01        RQLLQYTSKNTSGFWRYLFGSTLSKVVHRVKEDYREEFENILADCPG-LL
A0A3G8WH01_E1B19K-      RQLLQYTSKNTSGFWRYLFGSTLSKVVNRVKEDYREEFENILADCPG-LL
P04492_E1B19K-01        RQLLQYTSKNTSGFWRYLFGSTLSKVVNRVKEDYREEFENILADCPG-LL
A0A2H5AI99_E1B19K-      RQLLESASDKTSKFWRFCFGSTLSNVVYRVKKEQAEQFSRLLAEIPG-VF
A0A0M3TH31_E1B19K-      RKLLETACEKTSSCWRFFFGSTLSNVVHRVKREHSEEFSRLVADVPG-LF
M9YXY5_E1B19K-01        RKLLETACEKTSSCWRFFFGSTLSNVVHRVKREHSEEFSRLVADVPG-LF
M9YVF6_E1B19K-01        RKLLETACEKNRSCWRFFFGSTLSNVVHRVKREHSEEFSRLVADVPG-LF
A0MK43_E1B19K-01        RRLLELASDKTSRLWRFWFGSTLSSVVYRVKREQEAQFARLLADTPG-VF
A0A2H5AI21_E1B19K-      RRLLELASDRTSKFWRFCFGSTLSNVLYRVKKEQETQFARLLADTPG-VF
A0A0M5L3Y4_E1B19K-      RRLLELASDRTSKFWRFCFGSTLSNVLYRVKKEQETQFARLLADTPG-VF
Q5C8R2_E1B19K-01        RRLLELASDRTSKFWRFCFGSTLSNVLYRVKKEQETQFARLLADTPG-VF
A0A0A1EUB2_E1B19K-      RRLLELASDRTSKFWRFCFGSTLSNVLYRVKKEQETQFARLLADTPG-VF
A0A0A1EUC8_E1B19K-      RRLLELASDRTSKFWRFCFGSTLSNVLYRVKKEQETQFARLLADTPG-VF
A0A2H5AI04_E1B19K-      RRLLELASDRTSKFWRFCFGSTLSNVLYRVKKEQETQFARLLADTPG-VF
A0A2H5AI72_E1B19K-      RRLLELASDRTSKFWRFCFGSTLSNVLYRVKKEQETQFARLLADTPG-VF
A0A2H5AIL3_E1B19K-      RRLLELASDRTSKFWRFCFGSTLSNVLYRVKKEQETQFARLLADTPG-VF
A0A2H4CJZ0_E1B19K-      RHLLELASARTSTCWRFCFGSTLSNVVYRVKQEYSSRFSELLARYPA-VF
H8PFZ1_E1B19K-01        RRLLELASARTSTCWRFCFGSTLSNVVYRVKQEYSSRFSELLARYPA-VF
A0A1S6ELT2_E1B19K-      RRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRFAELLSFNPG-IF
A0A3G4W995_E1B19K-      RRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRFAELLSFNPG-IF
B5SNR1_E1B19K-01        RRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRFAELLSFNPG-IF
P10544_E1B19K-01        RRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRFAELLSFNPG-IF
W0S1G8_E1B19K-01        RRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRFAELLSFNPG-IF
A0A3G8W407_E1B19K-      RRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRFAELLSFNPG-IF
F4ZCJ8_E1B19K-01        RRLLELASARTSSCWRFIFGSTLTNVIYRAKEDYSSRFAELLSFNPG-IF
A0A142G3J2_E1B19K-      RRLLELASARTSSCWRILFGSTLANVIYRAKEEYSSRFADLLSHNPG-IF
P10543_E1B19K-01        RRLLELASARTSSCWRILFGSTLTNVIYRAKEEYSSRFADLLSHNPG-IF
A0A3S9SNH4_E1B19K-      RNLLEQSSNSTSWFWRFLWGSSQAKLVCRVKEDYKWEFEELLKSCGE-LF
A0A3S9SSS2_E1B19K-      RNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGE-LF
A0A3S9SNY0_E1B19K-      RNLLEQSSNSTSWFWRFLWGSCQAKLVCRIKEDYKWEFEELLKSCGE-LF
Q71BY5_E1B19K-02        RNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGE-LF
A0A3Q9HJ63_E1B19K-      RNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGE-LF
A0A3Q9HLF7_E1B19K-      RNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGE-LF
E1ARN8_E1B19K-01        RNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGE-LF
A0A2H4PJ75_E1B19K-      RNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGE-LF
Q6WQ37_E1B19K-01        RNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGE-LF
P03246_E1B19K-01        RNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGE-LF
Q6VGV8_E1B19K-01        RNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGE-LF
A0A0G2R248_E1B19K-      RNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGE-LF
A0A3Q9HJ54_E1B19K-      RNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGE-LF
A0A3S9SND6_E1B19K-      RNLLEQSSNSTSWFWRFLWGSSQAKLVCRVKEDYKWEFEELLKSCGE-LF
A0A3S9SP19_E1B19K-      RNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEDLLKSCGE-LF
A0A291P1B2_E1B19K-      RNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGE-LF
T1UG63_E1B19K-01        RNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGE-LF
A0A1U9ALK7_E1B19K-      RNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGE-LF
P03247_E1B19K-01        RNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGE-LF
A0A3G8W3H5_E1B19K-      RNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGE-LF
J9Z5H0_E1B19K-01        RNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGE-LF
J9Z4N4_E1B19K-01        RNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGE-LF
A0A3Q9HJZ5_E1B19K-      RNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGE-LF
J7I6T8_E1B19K-01        RNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGE-LF
J9Z4H6_E1B19K-01        RNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWEFEELLKSCGE-LF
P06501_E1B19K-01        RRLLELCSNRTSFLWRWLFGTPLSRLVRQVKLEYEKDFERILDQCPG-VF
A0A0M4N3Z1_E1B19K-      RRLLELCSNRTSFLWRWLFGTPLSRLVRQVKLEYEKDFERILDQCPG-VF
Q8B6X5_E1B19K-01        RRLLELCSNRTSFLWRWLFGTPLSRLVRQVKLEYEKDFERILDQCPG-VF
H9AAD9_E1B19K-01        RRLVELCSNRSSWFGRFLFGSTLCRVVRQVKEEYQSEFEHILSNCPG-LF
H9AAH3_E1B19K-01        RRLVELCSNRSSWFGRFLFGSTLCRVVRQVKEEYQSEFEHILSNCPG-LF
H9AAA8_E1B19K-01        RCLLELCSNRASWWKRLLFGTSLCRLVRQVKEEYQSEFEHILSTCQG-LF
M9YVA3_E1B19K-01        RCLLELCSNRDPWWKRLLFGTSLCRLVRQVKEEYQSEFEHILSTCQG-LF
F2WTJ7_E1B19K-01        RCLLELCSNRASWWKRLLFGTSLCRLVRQVKEEYESEFEHILSTCQG-LF
F2WTM9_E1B19K-01        RCLLELCSNRASWWKRLLFGTSLCRLVRQVKEEYESEFEHILSTCQG-LF
H9AA76_E1B19K-01        RCLLELCSNRASWWKRLLFGTSLCRLVRQVKEEYQSEFEHILSTCQG-LF
A0A1C8EG46_E1B19K-      RCLLELCSNRASWWKRLLFGTSLCRLVRQVKEEYQSEFEHILSTCQG-LF
H9AAN8_E1B19K-01        RCLLELCSNRASWWKRLLFGTSLCRLVRQVKEEYQSEFEHILSTCQG-LF
H9AAS0_E1B19K-01        RCLLELCSNRASWWKRLLFGTSLCRLVRQVKEEYQSEFEHILSTCQG-LF
H9AAV3_E1B19K-01        RCLLELCSNRASWWKRLLFGTSLCRLVRQVKEEYQSEFEHILSTCQG-LF
H9AAY5_E1B19K-01        RCLLELCSNRASWWKRLLFGTSLCRLVRQVKEEYQSEFEHILSTCQG-LF
A0A1L3INW0_E1B19K-      RQLLEEASNSTSYCWRFLFGSPLGRFLYRVKKDHQEEFDQLIGLFPT-IF
F6KST6_E1B19K-01        RRLLEEASDRTSYFWRFLCGSPLSRFLNRVKREHRAEFDELLEHLPG-LF
F2WTG5_E1B19K-01        RRLLEEASDRTSYIWRFLFGSPLSRFLYRVKREHLTEFDGLLEQLPG-LF
Q695T5_E1B19K-01        RRLLEEASDRTSYIWRFLFGSPLSRFLYRVKREHLTEFDGLLEQLPG-LF
H9TER0_E1B19K-01        RRLLEEASDRTSYIWRFLFGSPLSRFLHRVKREHLTEFDGLLEQLPG-LF
A0A0G2UY10_E1B19K-      RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSG-LL
X4Y9D2_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSG-LL
C5HDR2_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSG-LL
M0QVC7_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSG-LL
A0A3S6PYX7_E1B19K-      RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSG-LL
Q4KSL0_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSG-LL
A0A1P7YYY5_E1B19K-      RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFADCSG-LL
A0A1P8C849_E1B19K-      RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFADCSG-LL
B9A5L5_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFADCSG-LL
T1UGY3_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFADCSG-LL
A0A1P7YWR9_E1B19K-      RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENIFADCSG-LL
A0A1P7YWY2_E1B19K-      RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENIFADCSC-LL
A0A1P7YXN8_E1B19K-      RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENIFADCSC-LL
B9A5A7_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFADCSG-LL
T1UG22_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFADCSG-LL
H5T740_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLARLVYTVKKDYQDEFENLFADCSG-LL
A0A1J0MS84_E1B19K-      RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSG-LL
A0A097I4T0_E1B19K-      RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSG-LL
E5RWD9_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSG-LL
M0QU76_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEIENLFADCSG-LL
B9A5T7_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSG-LL
D3GBW3_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSG-LL
M0QUF3_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSG-LL
E5RWL1_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSG-LL
B6C6W8_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSG-LL
M0QU41_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSG-LL
F1DT57_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSG-LL
B2VQE3_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSG-LL
B9A681_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSG-LL
A0A1Y1BYF1_E1B19K-      RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSG-LL
B6DU90_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSG-LL
T1UHZ2_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSG-LL
A0A3Q9FFS0_E1B19K-      RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSG-LL
T1ULJ8_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSG-LL
T1UHG3_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSG-LL
E9P585_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSG-LL
A0A1Y1BXT7_E1B19K-      RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSG-LL
T1UHL7_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSG-LL
A0A075TSZ1_E1B19K-      RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSG-LL
T1UHH6_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSG-LL
T1UKP8_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSG-LL
B9A5Q1_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSG-LL
M0QUB4_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSG-LL
M0QUJ3_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSG-LL
M0QUN2_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSG-LL
C4P207_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSG-LL
E1CIM6_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSG-LL
D4N3H6_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSG-LL
M0QVK6_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSG-LL
M0QVT4_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSG-LL
E1AI10_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSG-LL
H0PPE7_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSG-LL
A0A3G8WIY5_E1B19K-      RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSG-LL
Q9YL99_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSG-LL
K7ZLN6_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSG-LL
A0A384ZUF2_E1B19K-      RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSG-LL
A0A384ZUM9_E1B19K-      RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSG-LL
E1CIR1_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSG-LL
T1UHQ8_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSG-LL
T1ULP4_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSG-LL
A0A291B0H2_E1B19K-      RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFSDCSG-LL
W8VNG2_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFSDCSG-LL
F8UFP5_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFSDCSG-LL
M0QV87_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFSDCSG-LL
M0QU02_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYQEEFENLFADCSG-LL
T1UKV6_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYSEEFENLFSDCSG-LL
M0QV47_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLARLVYTVKKDYQEEFENLFADCSG-LL
M0QUW8_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLARLVYTVKKDYQEEFENLFADCSG-LL
E1CIJ0_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLARLVYTVKKDYQEEFENLFADCSG-LL
T1UGU0_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLARLVYTVKKDYQEEFENLFADCSG-LL
M0QVG6_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFVDCSG-LL
X4YVU5_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFVDCSG-LL
M0QUS9_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSG-LL
G1FBW4_E1B19K-01        RRLVEDSSDGCSGFWRHWFGSPLSRLVYTVKKDYQEEFENLFADCSG-LL
M0QVP5_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYQEEFENLFADCSG-LL
T1UKQ0_E1B19K-01        RRLVEDSSDGCSGFWRHWFGSPLSRLVYTVKKDYQEEFENLFADCSG-LL
W8CZB0_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSG-LL
G1FC01_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSG-LL
G3CK71_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSG-LL
T1UGT5_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSG-LL
T1UK99_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYQEEFENLFADCSG-LL
M0QTS5_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSG-LL
M0QV08_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSG-LL
G9JUV5_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSG-LL
T1UGX3_E1B19K-01        RRLVEDSSDGCSGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSG-LL
Q7T951_E1B19K-01        RQLLESASDGVSGFWRFWFASELARVVFRIKQDYKQEFEKLLVDCPG-LF
T1UE63_E1B19K-01        RQLLESASDGVSGFWRFWFASELARVVFRIKQDYKQEFEKLLVDCPG-LF
Q7T8D8_E1B19K-01        RQLLENASDGVSGFWRFWFASELARVVFRIKQDYKQEFEKLLVDCPG-LF
Q8B8U7_E1B19K-01        RQLLENASDGVSGFWRFWFASELARVVFRIKQDYNQEFEKLLVDCPG-LF
Q5UW22_E1B19K-01        RQLLENASDGVSGFWRFWFASELARVVFRIKQDYKQEFEKLLVDCPG-LF
W6EIX6_E1B19K-01        RQLLEDASDGVSGFWRFWFASELARVVFRIKQDYKEEFEKLLLDCPG-LF
Q3ZL02_E1B19K-01        RQLLEDASDGVSGFWRFWFASELARVVFRIKQDYKEEFEKLLVDCPG-LF
A0A1L7NRH1_E1B19K-      RQLLEDASDGVSGFWRFWFASELARVVFRIKQDYKEEFEKLLLDCPG-LF
T1UFS4_E1B19K-01        RQLLEDASDGVSGFWRFWFASELARVVFRIKQDYKEEFEKLLVDCPG-LF
Q32UI6_E1B19K-01        RQLLENASDGVSGFWRFWFASELARVVFRIKQDYKEEFEKLLVDCPG-LF
C7SRS7_E1B19K-01        RQLLENASDGVSGFWRFWFASEIARVVFRIKQDYKEEFEKLLVDCPG-LF
J7H4R9_E1B19K-01        RQLLENASDGVSGFWRFWFASELARVVFRIKQDYKEEFEKLLVDCPG-LF
D2DM83_E1B19K-01        RQLLENASDGVSGFWRFWFASELARVVFRIKQDYKEEFEKLLVDCPG-LF
J7I6W7_E1B19K-01        RQLLENASDGVSGFWRFWFASELARVVFRIKQDYKEEFEKLLVDCPG-LF
T1UJX4_E1B19K-01        RQLLENASDGVSGFWRFWFASELARVVFRIKQDYKEEFEKLLVDCPG-LF
T2CI10_E1B19K-01        RQLLENASDGVSGLWRFWFGGDLARLVFRIKQDYRQEFEKLLDDCPG-LF
A0A0K0PX99_E1B19K-      RLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPG-LF
A0A0K0PX35_E1B19K-      RLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPG-LF
A0A220VZ73_E1B19K-      RLLLENASDGVSGLWRFCFGGDLARLVFRIKQDYSVEFEKLLDDSPG-LF
R4HLE1_E1B19K-01        RLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDNSPG-LF
R4HMC6_E1B19K-01        RLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYSVEFEKLLDDSPG-LF
I1V161_E1B19K-01        RLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYSVEFEKLLDDSPG-LF
P03248_E1B19K-02        RLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYSVEFEKLLDDSPG-LF
Q6RK98_E1B19K-01        RLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYSVEFEKLLDDSPG-LF
J7I6Q4_E1B19K-01        RLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYSVEFEKLLDDSPG-LF
J7I6S4_E1B19K-01        RLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYSVEFEKLLDDSPG-LF
R4HLJ6_E1B19K-01        RLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPG-LF
R4HLA0_E1B19K-01        RLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPG-LF
Q2KSL3_E1B19K-01        RLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPG-LF
Q2Y0J3_E1B19K-01        KLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPG-LF
Q5EY83_E1B19K-01        RLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDIPG-LF
I6LEP5_E1B19K-01        RLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPG-LF
I6LES1_E1B19K-01        RLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPG-LF
T1UF50_E1B19K-01        RLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPG-LF
J7ID56_E1B19K-01        RLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPG-LF
A0A0B4SJH1_E1B19K-      RLLLENASDGVSGFWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPG-LF
A0A075IQ70_E1B19K-      RLLLENASDGVSGFWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPG-LF
Q2KS85_E1B19K-01        RLLLENASDGVSGFWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPG-LF
Q3ZKW2_E1B19K-01        RLLLENASDGVSGFWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPG-LF
K7NG43_E1B19K-01        RLLLENASDGVSGFWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPG-LF
Q2KRU2_E1B19K-01        RLLLENASDGVSGFWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPG-LF
T1UIP3_E1B19K-01        RLLLENASDGVSGFWRFWFGGDLARLVFRIKQDYREEFEKLLDDSPG-LF
Q6QPF3_E1B19K-01        RQLLENSSEGVSYLWRFCFGGPLAKLVYRAKQDYKEQFEDILRECPG-IF
Q6QPB7_E1B19K-01        RQLLENSSEGVSYLWRFCFGGPLAKLVYRAKQDYKDQFEDILRECPG-IF
Q6QPI9_E1B19K-01        RQLLENSSEGVSYLWRFCFGGPLAKLVYRAKQDYKDQFEDILRECPG-IF
P10406_E1B19K-01        RQLLENASNGVSHLWRFCFGGDLAKLVYRAKQDYREQFEDILRECPS-LF
Q5GFC7_E1B19K-01        RQLLENASNGVSYLWRFCFGGDLAKLVYRAKQDYREQFEDILRECPG-LF
A0A2R3WN62_E1B19K-      RQLLENASNGVSYLWRFCFGGDLAKLVYRAKQDYREQFEDILRECPG-LF
A0A3G9JTX5_E1B19K-      RQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQFDDILKECPG-LF
Q2KSM8_E1B19K-02        RQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQFDDILKECPG-LF
A0A2R3WNP3_E1B19K-      RQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQFDDILKECPG-LF
Q2KSG6_E1B19K-02        RQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQFDDILKECPG-LF
A0A2L1F392_E1B19K-      RQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQFDDILKECPG-LF
A0A3G9CMQ4_E1B19K-      RQLLENASNGVSYLWRFCFGGDLAKLVYRAKQDYREQFEDILRECPG-LF
Q5GFC8_E1B19K-01        RQLLENASNGVSYLWRFCFGGDLAKLVYRAKQDYREQFEDILRECPG-LF
Q6H1D7_E1B19K-01        RQLLENASNGVSYLWRFCFGGDLAKLVYRAKQDYREQFEDILRECPG-LF
A0A3G8W6L2_E1B19K-      RQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQFDDILKECPG-LF
Q2KSG6_E1B19K-01        RQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQFDDILKECPG-LF
Q2KSM8_E1B19K-01        RQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQFDDILKECPG-LF
A0A2R3WN16_E1B19K-      RQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQFDDILKECPG-LF
G9G841_E1B19K-01        RQLLENASNGVSHLWRFCFGGDLAKLVYRAKQDYSEQFEVILRECPG-LF
Q8UY91_E1B19K-01        RQLLENASNGVSYLWRFCFGGDLARLVYRAKQDYSEQFEVILRECSG-LF
                        . ::                      :   : .        .        

Q71BY5_E1B19K-01        -------------------------------------VLKWC--------
A0A0M4NHE0_E1B19K-      VSLDLGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFLLDRWN-AQTQLSP
H9AAK5_E1B19K-01        VSLDLGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFLLDRWN-AQTQLSP
G0ZAH2_E1B19K-01        NNLELGHTRALNG-VLRELDFENTGRVVAGLAFLAYLLDRWD-ENSVLSP
A0A3Q9HK00_E1B19K-      DSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSG
A0A3Q9HK78_E1B19K-      DSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSG
A0A3S9SPV1_E1B19K-      DSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSG
A0A1W5PVU4_E1B19K-      DSLNFCHHAFFYEKVICGLDFCTPGRTIAALAFCAFILDKWN-KETHLSR
A0A0M3TH18_E1B19K-      DSLNFCHHAFFYEKVICGLDFCTPGRTIAALAFCAFILDKWN-KETHLSK
A0A097IW62_E1B19K-      ESLNFCHHAVFYEKIICSLDFCTPGRTIAALAFCTYILDRWN-KETHLSA
A0A0A1EUE4_E1B19K-      VALDLGHHSLFQEKIVKSLTFSSPGRTVVSAAFITYILDQWSSSGSHLSW
A0A2H5AI40_E1B19K-      VALDLGHHSLFQEKIIRNLTFSSPGRTVASAAFVAYILDQWSNSNSHLSW
A0A2H5AID8_E1B19K-      VALDLGHHSLFQEKIIRNLTFSSPGRTVASAAFVAYILDQWSNSDSHLSW
A0A2H5AII9_E1B19K-      VALDLGHHSLFQEKIIRNLTFSSPGRTVASAAFVAYILDQWSNSNSHLSW
A0A2H5AIL0_E1B19K-      VALDLGHHSLFQEKIIRNLTFSSPGRTVASAAFVAYILDQWSNSDSHLSW
A0A2H5AIN5_E1B19K-      VALDLGHHSLFQEKIIRNLTFSSPGRTVASAAFVAYILDQWSNSNSHLSW
A0A2H5AIS9_E1B19K-      VALDLGHHSLFQEKIIRNLTFSSPGRTVASAAFVAYILDQWSNSDSHLSW
A0A2H5AIT6_E1B19K-      VALDLGHHSLFQEKIIRNLTFSSPGRTVASAAFVAYILDQWSNSDSHLSW
A0A2H5AIU0_E1B19K-      VALDLGHHSLFQEKIIRNLTFSSPGRTVASAAFVAYILDQWSNSNSHLSW
A0A2H5AIC5_E1B19K-      VALDLGHHSLFQEKIIRNLTFSSPGRTVASAAFITYILDQWSNSDSHLSW
D3JIR7_E1B19K-01        ASLDLCHHSIFQEKVVKSLDFSSAGRTVASIAFLVTVLDKWS-QTSQLSW
A0A076V686_E1B19K-      ASLDLCHHSIFQEKVVRSLDFSSAGRTVASIAFLVTVLDKWS-QASQLSW
G1DE13_E1B19K-01        ASLDLCHHSVFQERVVRSLDFSSSGRTVASIAFLVTVLDKWS-ERSHLSW
D0Z5R9_E1B19K-01        ASLDLCHHSVFQERVVRSLDFSSSGRTVASIAFLATVLDKWS-ERSHLSW
T1UEX7_E1B19K-01        ASLDLCHHSVFQERVVRSLDFSSSGRTVASIAFLATVLDKWS-ERSHLSW
A0A3G8WH01_E1B19K-      ASLDLCHHLVFQEKVVRSLDFSSVGRTVASIAFLATILDKWS-EKSHLSW
P04492_E1B19K-01        ASLDLCYHLVFQEKVVRSLDFSSVGRTVASIAFLATILDKWS-EKSHLSW
A0A2H5AI99_E1B19K-      VALDLGHHALFQEKVIKSLTFSSPGRVVTSLAFICHLLDKWS-SDSHLSW
A0A0M3TH31_E1B19K-      VSLDLGHHSYFQEKIVKGLVFESTGRTVVSVAFICFLLDKWS-SDSHLSW
M9YXY5_E1B19K-01        VSLDLGHHSYFQEKIVKGLVFESTGRTVVSVAFICFLLDKWS-SDSHLSW
M9YVF6_E1B19K-01        VSLDLGHHSYFQEKIVKGLVFESTGRTVVSVAFICFLLDKWS-SDSHLSW
A0MK43_E1B19K-01        VALDLGHHSLFQEKIIKNLTFTSPGRTVASAAFITYILDQWSNSDSHLSW
A0A2H5AI21_E1B19K-      VALDLGHHSLFQEKIIKNLTFTSPGRTVASAAFITYILDQWSNSDSHLSW
A0A0M5L3Y4_E1B19K-      VALDLGHHSLFQEKIIKNLTFTSPGRTVASAAFITYILDQWSNSDSHLSW
Q5C8R2_E1B19K-01        VALDLGHHSLFQEKIIKNLTFTSPGRTVASAAFITYILDQWSNSDSHLSW
A0A0A1EUB2_E1B19K-      VALDLGHHSLFQEKIIKNLTFTSPGRTVASAAFITYILDQWSNSGSHLSW
A0A0A1EUC8_E1B19K-      VALDLGHHSLFQEKIIKNLTFTSPGRTVASAAFITYILDQWSNSGSHLSW
A0A2H5AI04_E1B19K-      VALDLGHHSLFQEKIIKNLTFTSPGRTVASAAFITYILDQWSNSGSHLSW
A0A2H5AI72_E1B19K-      VALDLGHHSLFQEKIIKNLTFTSPGRTVASAAFITYILDQWSNSGSHLSW
A0A2H5AIL3_E1B19K-      VALDLGHHSLFQEKIIKNLTFTSPGRTVASAAFITYILDQWSNSGSHLSW
A0A2H4CJZ0_E1B19K-      ASLDLGHHVYFQEAVVRYLDFSTPGRTVSALAFICFVLDRWS-AQTRLSP
H8PFZ1_E1B19K-01        VSLDLGHHVYFQEAVVRYLDFSTPGRAVSAIAFICFVLDRWS-AQTRLSP
A0A1S6ELT2_E1B19K-      ASLNLGHHSFFQEIVIKNLDFSSPGRTVSGLAFICFILDQWS-AQTHLSE
A0A3G4W995_E1B19K-      ASLNLGHHSFFQEIVIKNLDFSSPGRTVSGLAFICFILDQWS-AQTHLSE
B5SNR1_E1B19K-01        ASLNLGHHSFFQEIVIKNLDFSSPGRTVSGLAFICFILDQWS-AQTHLSE
P10544_E1B19K-01        ASLNLGHHSFFQEIVIKNLDFSSPGRTVSGLAFICFILDQWS-AQTHLSE
W0S1G8_E1B19K-01        ASLNLGHHSFFQEIVIKNLDFSSPGRTVSGLAFICFILDQWS-AQTHLSE
A0A3G8W407_E1B19K-      ASLNLGHHSFFQEIVIKNLDFSSPGRTVSGLAFICFILDQWS-AQTHLSE
F4ZCJ8_E1B19K-01        ASLNLGHHSFFQEIVIKNLDFSSPGRTVSGLAFICFILDQWS-AQTHLSE
A0A142G3J2_E1B19K-      ASLNLGHHSFFQEIVIRNLDFSSPGRTVSGLAFICFILDQWS-AQTHLSQ
P10543_E1B19K-01        ASLNLGHHSFFQEIVIRNLDFSSPGRTVSGLAFICFILDQWS-AQTHLSQ
A0A3S9SNH4_E1B19K-      DSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSG
A0A3S9SSS2_E1B19K-      DSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSG
A0A3S9SNY0_E1B19K-      DSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSG
Q71BY5_E1B19K-02        DSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSG
A0A3Q9HJ63_E1B19K-      DSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSG
A0A3Q9HLF7_E1B19K-      DSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSG
E1ARN8_E1B19K-01        DSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSG
A0A2H4PJ75_E1B19K-      DSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSG
Q6WQ37_E1B19K-01        DSLNLGHQALLQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSG
P03246_E1B19K-01        DSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSG
Q6VGV8_E1B19K-01        DSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSG
A0A0G2R248_E1B19K-      DSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSG
A0A3Q9HJ54_E1B19K-      DSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSG
A0A3S9SND6_E1B19K-      DSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSG
A0A3S9SP19_E1B19K-      DSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSG
A0A291P1B2_E1B19K-      DSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSG
T1UG63_E1B19K-01        DSLNLGHQALFQEKVIKTLDFSTPGRTAAAVAFLSFIKDKWS-EETHLSG
A0A1U9ALK7_E1B19K-      DSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSG
P03247_E1B19K-01        DSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSG
A0A3G8W3H5_E1B19K-      DSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSG
J9Z5H0_E1B19K-01        DSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSG
J9Z4N4_E1B19K-01        DSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSG
A0A3Q9HJZ5_E1B19K-      DSLNLGHQALFQEKVIKTLDFSTPGRVAAAVAFLSFIKDKWS-EETHLSG
J7I6T8_E1B19K-01        DSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSG
J9Z4H6_E1B19K-01        DSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDKWS-EETHLSG
P06501_E1B19K-01        ESLELGYHKVFEEKIVKELDFSSPGRAVAAVAFASYLLDRWN-TRTHLSP
A0A0M4N3Z1_E1B19K-      ESLELGYHKVFEDKIVKELDFSSPGRAVAAVAFASYLLDRWN-TRTHLSP
Q8B6X5_E1B19K-01        ESLELGYHKVFEDKIVKELDFSSPGRAVAAVAFASYLLDRWN-TRTHLSP
H9AAD9_E1B19K-01        VSLDLGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFLLDRWN-AQTQLSP
H9AAH3_E1B19K-01        VSLDLGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFLLDRWN-AQTQLSP
H9AAA8_E1B19K-01        ESLELGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFILDRWN-TQTQLSP
M9YVA3_E1B19K-01        ESLELGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFILDRWN-TQTQLSP
F2WTJ7_E1B19K-01        ESLELGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFILDRWN-SQTQLSP
F2WTM9_E1B19K-01        ESLELGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFILDRWN-SQTQLSP
H9AA76_E1B19K-01        ESLELGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFILDRWN-TQTQLSP
A0A1C8EG46_E1B19K-      ESLELGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFILDRWN-TQTQLSP
H9AAN8_E1B19K-01        ESLELGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFILDRWN-TQTQLSP
H9AAS0_E1B19K-01        ESLELGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFILDRWN-TQTQLSP
H9AAV3_E1B19K-01        ESLELGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFILDRWN-TQTQLSP
H9AAY5_E1B19K-01        ESLELGHHTVFQEKIVKALDFSSPGRAVAAIAFAAFILDRWN-TQTQLSP
A0A1L3INW0_E1B19K-      ESLNLGHKTLLEDKLLVQLDFSTPGRACSGLAFVVHLLDRWN-QETYLSP
F6KST6_E1B19K-01        DSLNLGHRVLLEERLFPQLDFSSPGRLCSALAFVVHLLDRWN-EQTQLSP
F2WTG5_E1B19K-01        DSLNLGHRTLLEERLFPQLDFSSPGRLCSALAFAVHLLDRWN-EQTQLSP
Q695T5_E1B19K-01        DSLNLGHRTLLEERLFPQLDFSSPGRLCSALAFAVHLLDRWN-EQTQLSP
H9TER0_E1B19K-01        DSLNLGHRTLLEERLFPQLDFSSPGRLCSALAFAVHLLDRWN-EQTQLSP
A0A0G2UY10_E1B19K-      DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSR
X4Y9D2_E1B19K-01        DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWR-QDTQLSR
C5HDR2_E1B19K-01        DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSR
M0QVC7_E1B19K-01        DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSR
A0A3S6PYX7_E1B19K-      DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSR
Q4KSL0_E1B19K-01        DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
A0A1P7YYY5_E1B19K-      DSLNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
A0A1P8C849_E1B19K-      DSLNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
B9A5L5_E1B19K-01        DSLNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
T1UGY3_E1B19K-01        DSLNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
A0A1P7YWR9_E1B19K-      DSLNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
A0A1P7YWY2_E1B19K-      DSLNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
A0A1P7YXN8_E1B19K-      DSLNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
B9A5A7_E1B19K-01        DSLNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
T1UG22_E1B19K-01        DSLNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
H5T740_E1B19K-01        DSLNLGHQALFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QQTHLTR
A0A1J0MS84_E1B19K-      DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSR
A0A097I4T0_E1B19K-      DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSR
E5RWD9_E1B19K-01        DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVACVVFLVDKWS-QNTQLSR
M0QU76_E1B19K-01        DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSR
B9A5T7_E1B19K-01        DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSR
D3GBW3_E1B19K-01        DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSR
M0QUF3_E1B19K-01        DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSR
E5RWL1_E1B19K-01        DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSR
B6C6W8_E1B19K-01        DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSR
M0QU41_E1B19K-01        DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSR
F1DT57_E1B19K-01        DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSR
B2VQE3_E1B19K-01        DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSR
B9A681_E1B19K-01        DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSR
A0A1Y1BYF1_E1B19K-      DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSR
B6DU90_E1B19K-01        DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSR
T1UHZ2_E1B19K-01        DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSR
A0A3Q9FFS0_E1B19K-      DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSR
T1ULJ8_E1B19K-01        DSLNLGHQALFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
T1UHG3_E1B19K-01        DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
E9P585_E1B19K-01        DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
A0A1Y1BXT7_E1B19K-      DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
T1UHL7_E1B19K-01        DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
A0A075TSZ1_E1B19K-      DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
T1UHH6_E1B19K-01        DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
T1UKP8_E1B19K-01        DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
B9A5Q1_E1B19K-01        DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
M0QUB4_E1B19K-01        DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
M0QUJ3_E1B19K-01        DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
M0QUN2_E1B19K-01        DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
C4P207_E1B19K-01        DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
E1CIM6_E1B19K-01        DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
D4N3H6_E1B19K-01        DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
M0QVK6_E1B19K-01        DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
M0QVT4_E1B19K-01        DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
E1AI10_E1B19K-01        DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
H0PPE7_E1B19K-01        DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
A0A3G8WIY5_E1B19K-      DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
Q9YL99_E1B19K-01        DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
K7ZLN6_E1B19K-01        DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
A0A384ZUF2_E1B19K-      DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
A0A384ZUM9_E1B19K-      DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
E1CIR1_E1B19K-01        DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
T1UHQ8_E1B19K-01        DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
T1ULP4_E1B19K-01        DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
A0A291B0H2_E1B19K-      DSLNLGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
W8VNG2_E1B19K-01        DSLNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSR
F8UFP5_E1B19K-01        DSLNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSR
M0QV87_E1B19K-01        DSLNFGHQSLFQERVLHSLDFSTPGRTTAGVAFVVFLVDKWS-QDTQLSR
M0QU02_E1B19K-01        DSLNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
T1UKV6_E1B19K-01        DSLNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
M0QV47_E1B19K-01        DSLNLGHQALFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QQTHLTR
M0QUW8_E1B19K-01        DSLNLGHQALFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QQTHLTR
E1CIJ0_E1B19K-01        DSLNLGHQALFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QQTHLTR
T1UGU0_E1B19K-01        DSLNLGHQALFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QQTHLTR
M0QVG6_E1B19K-01        DSLNLGHQALFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QQTHLTR
X4YVU5_E1B19K-01        DSLNLGHQALFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QQTHLTR
M0QUS9_E1B19K-01        DSLNLGHQALFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QDTQLSR
G1FBW4_E1B19K-01        DSLNLGHQALFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QQTHLTR
M0QVP5_E1B19K-01        DSLNLGHQALFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QQTHLTR
T1UKQ0_E1B19K-01        DSLNLGHQALFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QQTHLTR
W8CZB0_E1B19K-01        DSLNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSR
G1FC01_E1B19K-01        DSLNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSR
G3CK71_E1B19K-01        DSLNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSR
T1UGT5_E1B19K-01        DSLNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSR
T1UK99_E1B19K-01        DSLNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QQTHLTR
M0QTS5_E1B19K-01        DSLNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSR
M0QV08_E1B19K-01        DSLNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSR
G9JUV5_E1B19K-01        DSLNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSR
T1UGX3_E1B19K-01        DSLNFGHQSLFQERVLHSLDFSSPGRTTAGVAFVVFLVDKWS-QNTQLSR
Q7T951_E1B19K-01        EALNLGHQVHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSR
T1UE63_E1B19K-01        EALNLGHQVHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSR
Q7T8D8_E1B19K-01        EALNLGHQVHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSR
Q8B8U7_E1B19K-01        EALNLGHQVHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSR
Q5UW22_E1B19K-01        EALNLGHQVHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSR
W6EIX6_E1B19K-01        EALNLGHQVHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSR
Q3ZL02_E1B19K-01        EALNLGHQVHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSR
A0A1L7NRH1_E1B19K-      EALNLGHQVHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSR
T1UFS4_E1B19K-01        EALNLGHQVHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSR
Q32UI6_E1B19K-01        EALNLGHQVHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSR
C7SRS7_E1B19K-01        EALNLGHQVHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSR
J7H4R9_E1B19K-01        EALNLGHQVHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSR
D2DM83_E1B19K-01        EALNLGHQVHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSR
J7I6W7_E1B19K-01        EALNLGHQVHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSR
T1UJX4_E1B19K-01        EALNLGHQVHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-PQTHFSR
T2CI10_E1B19K-01        EALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFIFDKWI-PQTHFSK
A0A0K0PX99_E1B19K-      EALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSR
A0A0K0PX35_E1B19K-      EALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSK
A0A220VZ73_E1B19K-      EALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSK
R4HLE1_E1B19K-01        EALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSK
R4HMC6_E1B19K-01        EALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSK
I1V161_E1B19K-01        EALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSK
P03248_E1B19K-02        EALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSK
Q6RK98_E1B19K-01        EALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSK
J7I6Q4_E1B19K-01        EALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSK
J7I6S4_E1B19K-01        EALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSK
R4HLJ6_E1B19K-01        EALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSK
R4HLA0_E1B19K-01        EALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSK
Q2KSL3_E1B19K-01        EALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSK
Q2Y0J3_E1B19K-01        EALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSK
Q5EY83_E1B19K-01        EALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSK
I6LEP5_E1B19K-01        EALNLGHRAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSK
I6LES1_E1B19K-01        EALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSK
T1UF50_E1B19K-01        EALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSK
J7ID56_E1B19K-01        EALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSK
A0A0B4SJH1_E1B19K-      EALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSK
A0A075IQ70_E1B19K-      EALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSK
Q2KS85_E1B19K-01        EALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSK
Q3ZKW2_E1B19K-01        EALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSK
K7NG43_E1B19K-01        EALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSK
Q2KRU2_E1B19K-01        EALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSK
T1UIP3_E1B19K-01        EALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFILDKWI-RQTHFSK
Q6QPF3_E1B19K-01        DSLNLGHQSHFNQSILRALDFSTPGRTTAAVAFFAFILDKWS-QETHFSR
Q6QPB7_E1B19K-01        DSLNLGHQSHFNQSILRALDFSTPGRTTAAVAFFAFILDKWS-QETHFSR
Q6QPI9_E1B19K-01        DSLNLGHQSHFNQSILRALDFSTPGRTTAAVAFFAFILDKWS-QETHFSR
P10406_E1B19K-01        DALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFIFDKWS-QETHFSR
Q5GFC7_E1B19K-01        DALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFIFDKWS-QETHFSR
A0A2R3WN62_E1B19K-      DALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFIFDKWS-QETHFSR
A0A3G9JTX5_E1B19K-      DALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFVLDKWS-QETHFSR
Q2KSM8_E1B19K-02        DALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFVLDKWS-QETHFSR
A0A2R3WNP3_E1B19K-      DALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFVLDKWS-QETHFSR
Q2KSG6_E1B19K-02        DALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFVLDKWS-QETHFSR
A0A2L1F392_E1B19K-      DALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFVLDKWS-QETHFSR
A0A3G9CMQ4_E1B19K-      DALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFIFDKWS-QETHFSR
Q5GFC8_E1B19K-01        DALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFIFDKWS-QETHFSR
Q6H1D7_E1B19K-01        DALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFIFDKWS-QETHFSR
A0A3G8W6L2_E1B19K-      DALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFVLDKWS-QETHFSR
Q2KSG6_E1B19K-01        DALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFVLDKWS-QETHFSR
Q2KSM8_E1B19K-01        DALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFVLDKWS-QETHFSR
A0A2R3WN16_E1B19K-      DALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFVLDKWS-QETHFSR
G9G841_E1B19K-01        DALNLGHQTHFNQRIVRALDFTTPGRSTAAVAFFAFLLDKWS-QETHFSR
Q8UY91_E1B19K-01        DALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFILDKWS-QETHFSR
                                                               .*         

Q71BY5_E1B19K-01        --------------LLS---------------------------------
A0A0M4NHE0_E1B19K-      GYTLDYISLQLWRFWLR-----------RRVYNYSRGLPPLGLASVAEER
H9AAK5_E1B19K-01        GYTLDYISLQLWRFWLR-----------RRVYNYSRGLPPLGLASVAEER
G0ZAH2_E1B19K-01        GYRLDCLALAIWKHTLREGILRGVMQGPRARVNREIRREVEERLTQVQRE
A0A3Q9HK00_E1B19K-      GYLLDFLAMHLWRAVVR--------HKNRLLLLSSVRPAIIPTEE-----
A0A3Q9HK78_E1B19K-      GYLLDFLAMHLWRAVVR--------HKNRLLLLSSVRPAIIPTEE-----
A0A3S9SPV1_E1B19K-      GYLLDFLAMHLWRAVVR--------HKNRLLLLSSVRPAIIPTEEQQQQQ
A0A1W5PVU4_E1B19K-      GYTLDYISLQLWKAYMR---KG---KIYTFSQGPRSLPQRVRRRLGFQTE
A0A0M3TH18_E1B19K-      GYTLDYISLQLWKAYMR---KGKIYTFSQGPRSLPQ---RVRRRLGFKTE
A0A097IW62_E1B19K-      GYTLDYITLQLWKAYMR---KGKIYTFSREPRSLQRLQTSLRRRLGMPTD
A0A0A1EUE4_E1B19K-      DYMLDYLAMALWRAMLR---RR---VCIYSRAQPPRLDRVVEEDE-----
A0A2H5AI40_E1B19K-      EYMLDYMAMALWRAMLR---RR---VCIYLRAQPPRLDRVVEENE-----
A0A2H5AID8_E1B19K-      EYMLDYMAMALWRAMLR---RR---VCIYLRAQPPRLDRVVEENE-----
A0A2H5AII9_E1B19K-      EYMLDYMAMALWRAMLR---RR---VCIYLRAQPPRLDRVVEENE-----
A0A2H5AIL0_E1B19K-      EYMLDYMAMALWRAMLR---RR---VCIYLRAQPPRLDRVVEENE-----
A0A2H5AIN5_E1B19K-      EYMLDYMAMALWRAMLR---RR---VCIYLRAQPPRLDRVVEENE-----
A0A2H5AIS9_E1B19K-      EYMLDYMAMALWRAMLR---RR---VCIYLRAQPPRLDRVVEENE-----
A0A2H5AIT6_E1B19K-      EYMLDYMAMALWRAMLR---RR---VCIYLRAQPPRLDRVVEENE-----
A0A2H5AIU0_E1B19K-      EYMLDYMAMALWRAMLR---RR---VCIYLRAQPPRLDRVVEENE-----
A0A2H5AIC5_E1B19K-      EYMLDYMAMALWRAMLR---RR---VCIYLRAQPPRLDRVVEENE-----
D3JIR7_E1B19K-01        DYMLDYMAMQLWRAWLT---RR--VCI-YSLARPLT-MPRLPTLQEEE--
A0A076V686_E1B19K-      DYMLDYMTMQLWRAWLT---RR--VCI-YSLARPLT-MPRLPTLQEEP--
G1DE13_E1B19K-01        DYMLDYMAMHLWRAWLK---RR--VCI-YSLARPLT-MPPL---------
D0Z5R9_E1B19K-01        DYMLDYMAMHLWRAWLK---RR--VCI-YSLARPLT-MPPL---------
T1UEX7_E1B19K-01        DYMLDYMAMHLWRAWLK---RR--VCI-YSLARPLT-MPPL---------
A0A3G8WH01_E1B19K-      DYMLDYMSMQLWRAWLK---RR--VCI-YSLARPLT-MPPLPTLQEEK--
P04492_E1B19K-01        DYMLDYMSMQLWRAWLK---RR--VCI-YSLARPLT-MPPLPTLQEEK--
A0A2H5AI99_E1B19K-      NYMLDYLSMAVWRAML----RK--RVCIYLRAQPPR-LDRVE--EEDE--
A0A0M3TH31_E1B19K-      DYMLDYMTMALWRALLR---RR--RACIYLPVQPQRGLERVE--EEEE--
M9YXY5_E1B19K-01        DYMLDYMTMALWRALLR---RR--RACIYLPVQPQRGLERVE--EEEE--
M9YVF6_E1B19K-01        DYMLDYMTMALWRALLR---RR--RACIYLPVQPQQGLERVE--EEEE--
A0MK43_E1B19K-01        EYMLDYMAMALWRAMLR---RR--VCI-YLRAQPPR-LDRVV--EENE--
A0A2H5AI21_E1B19K-      EYMLDYMAMALWRAMLR---RR--VCI-YLRAQPPR-LDRVV--EENE--
A0A0M5L3Y4_E1B19K-      EYMLDYMAMALWRAMLR---RR--VCI-YLRAQPPR-LDRVV--EENE--
Q5C8R2_E1B19K-01        EYMLDYMAMALWRAMLR---RR--VCI-YLRAQPPR-LDRVV--EENE--
A0A0A1EUB2_E1B19K-      EYMLDYMSMALWRAMLR---RR--VCI-YLRAQPPR-LGRVE--EEDE--
A0A0A1EUC8_E1B19K-      EYMLDYMSMALWRAMLR---RR--VCI-YLRAQPPR-LDRVE--EEDE--
A0A2H5AI04_E1B19K-      EYMLDYMSMALWRAMLR---RR--VCI-YLRAQPPR-LDRVE--EEDE--
A0A2H5AI72_E1B19K-      EYMLDYMSMALWRAMLR---RR--VCI-YLRAQPPR-LDRVE--EEDE--
A0A2H5AIL3_E1B19K-      EYMLDYMSMALWRAMLR---RR--VCI-YLRAQPPR-LDRVE--EEDE--
A0A2H4CJZ0_E1B19K-      GYTLDYLTMSLWRAMLR---KR--RVSGFSPARPPHGLDPVL--EEPE--
H8PFZ1_E1B19K-01        GYTLDYLTMSLWRAMLR---KR--RVSGFSPARPPHGLDPVL--EESE--
A0A1S6ELT2_E1B19K-      GYTLDYMTMALWRTLLR---RK--RVLGCSPAQPPHGLDPVR-EEEEE--
A0A3G4W995_E1B19K-      GYTLDYMTMALWRTLLR---RK--RVLGCSPAQPPHGLDPVR-----E--
B5SNR1_E1B19K-01        GYTLDYMTMALWRTLLR---RK--RVLGCSPAQPPHGLDPVR-EEEEE--
P10544_E1B19K-01        GYTLDYMTMALWRTLLR---RK--RVLGCSPAQPPHGLDPVR---EEE--
W0S1G8_E1B19K-01        GYTLDYMTMALWRTLLR---RK--RVLGCSPAQPPHGLDPVR---EEE--
A0A3G8W407_E1B19K-      GYTLDYMTMALWRTLLR---RK--RVLGCSPAQPPHGLDPVR--------
F4ZCJ8_E1B19K-01        GYTLDYMTMALWRTLLR---RK--RVLGCSPAQPPHGLDPVREEEEEE--
A0A142G3J2_E1B19K-      GYTLDYMAMALWRTLLR---RK--RVLGCLPAQRPHGLDPVQ----EE--
P10543_E1B19K-01        GYTLDYMAMALWRTLLR---RK--RVLGCLPAQRPHGLDPVQ----EE--
A0A3S9SNH4_E1B19K-      GYLLDFLAMHLWRAVVR---HK-----NRMLLLSSVRPAIIPTEE--QQQ
A0A3S9SSS2_E1B19K-      GYLLDFLAMHLWRAVVR---HK-----NRLLLLSSVRPAIPTEEQ--QQQ
A0A3S9SNY0_E1B19K-      GYLLDFLAMHLWRAVVR---HK-----NRLLLLSSVSPAIIPTEE--QQQ
Q71BY5_E1B19K-02        GYLLDFLAMHLWRAVVR---HK-----NRLLLLSSVRPAIIPTEE--QQQ
A0A3Q9HJ63_E1B19K-      GYLLDFLAMHLWRAVVR---HK-----NRLLLLSSVRPAIIPTEEQQQQQ
A0A3Q9HLF7_E1B19K-      GYLLDFLAMHLWRAVVR---HK-----NRLLLLSSVSPAIIPTEE--QQQ
E1ARN8_E1B19K-01        GYLLDFLAMHLWRAVVR---HK-----NRLLLLSSVRPAIIPTEE--QQQ
A0A2H4PJ75_E1B19K-      GYLLDFLAMHLWRAVVR---HK-----NRLLLLSSVRPAIIPTEE----Q
Q6WQ37_E1B19K-01        GYLLDFLAMHLWRAVVR---HK-----NRLLLLSSVRPAIIPTEE-----
P03246_E1B19K-01        GYLLDFLAMHLWRAVVR---HK-----NRLLLLSSVRPAIIPTEE-----
Q6VGV8_E1B19K-01        GYLLDFLAMHLWRAVVR---HK-----NRLLLLSSVRPAIIPTEE-----
A0A0G2R248_E1B19K-      GYLLDFLAMHLWRAVVR---HK-----NRLLLLSSVRPAIIPTEE-----
A0A3Q9HJ54_E1B19K-      GYLLDFLAMHLWRAVVR---HK-----NRLLLLSSVRPAIIPTEE-----
A0A3S9SND6_E1B19K-      GYLLDFLAMHLWRAVVR---HK-----NRMLLLSSVRPAIIPTEE---QQ
A0A3S9SP19_E1B19K-      GYLLDFLAMHLWRAVVR---HK-----NRLLLLSSVRPAIIPTEE-----
A0A291P1B2_E1B19K-      GYLLDFLAMHLWRAVVR---HK-----NRLLLLSSVRPAIIPTEE-----
T1UG63_E1B19K-01        GYLLDFLAMHLWRAVVR---HK-----NRLLLLSSVRPAIIPTEE-QQQQ
A0A1U9ALK7_E1B19K-      GYLLDFLAMHLWRAVVR---HK-----NRLLLLSSVRPAIIPTEE-----
P03247_E1B19K-01        GYLLDFLAMHLWRAVVR---HK-----NRLLLLSSVRPAIIPTEE-----
A0A3G8W3H5_E1B19K-      GYLLDFLAMHLWRAVVR---HK-----NRLLLLSSVRPAIIPTEE-----
J9Z5H0_E1B19K-01        GYLLDFLAMHLWRAVVR---HK-----NRLLLLSSVRPAIIPTEE-----
J9Z4N4_E1B19K-01        GYLLDFLAMHLWRAVVR---HK-----NRLLLLSSVRPAIIPTEE-----
A0A3Q9HJZ5_E1B19K-      GYLLDFLAMHLWRAVVR---HK-----NGLLLLSSVRPAIIPTEE-QQQQ
J7I6T8_E1B19K-01        GYLLDFLAMHLWRAVVR---HK-----NRLLLLSSVRPAIIPTEE---QQ
J9Z4H6_E1B19K-01        GYLLDFLAMHLWRAVVR---HK-----NRLLLLSSVRPAIIPTEE-QQQQ
P06501_E1B19K-01        GYQMDYISLNLWKFWLR---RRVYNYSRGL---PQLGPAAPLARQ---GS
A0A0M4N3Z1_E1B19K-      GYQMDYISLNLWKFWLR---RRVYNYSRGL---PQLGPVAPLVRQ---GS
Q8B6X5_E1B19K-01        GYQMDYIRLNLWKFWLR---RRVYNYSRGL---PQLGPVAPLVRQ---GS
H9AAD9_E1B19K-01        GYTLDYISLQLWRFWLR---RRVYNYSRGL---PPLGLASVAEER---SE
H9AAH3_E1B19K-01        GYTLDYISLQLWRFWLR---RRVYNYSRGL---PPLGLASVAEER---SE
H9AAA8_E1B19K-01        GYTLDYISLQLWRFWLR---RRVYNYSRGL---PPLGRASSPEEQ---SP
M9YVA3_E1B19K-01        GYTLDYISLQLWRFWLR---RRVYNYSRGL---PPLGRASSPEEQ---SP
F2WTJ7_E1B19K-01        GYTLDYISLQLWRFWLR---RRVYNYSRGL---PPLGRASLPEEQ---SP
F2WTM9_E1B19K-01        GYTLDYISLQLWRFWLR---RRVYNYSRGL---PPLGRASLPEEQ---SP
H9AA76_E1B19K-01        GYTLDYISLQLWRFWLR---RRVYNYSRGL---PPLGRASSPEEQ---SP
A0A1C8EG46_E1B19K-      GYTLDYISLQLWRFWLR---RRVYNYSRGL---PPLGRASSPEEQ---LP
H9AAN8_E1B19K-01        GYTLDYISLQLWRFWLR---RRVYNYSRGL---PPLGRASSPEEQ---SP
H9AAS0_E1B19K-01        GYTLDYISLQLWRFWLR---RRVYNYSRGL---PPLGRASSPEEQ---SP
H9AAV3_E1B19K-01        GYTLDYISLQLWRFWLR---RRVYNYSRGL---PPLGRASSPEEQ---SP
H9AAY5_E1B19K-01        GYTLDYISLQLWRFWLR---RRVYNYSRGL---PPLGRASSPEEQ---SP
A0A1L3INW0_E1B19K-      GYTLDFLTLSLWKTGLK---RGRKLYGRMLERHPSLIQKTVRAQV---LS
F6KST6_E1B19K-01        GYTLDFLTLCLWKFGIR---KGRKLYRRLVERHPSLRQHRLQAQA---LL
F2WTG5_E1B19K-01        GYTLDFLTLCLWKFGIR---RGRKLYGRLVERHPSLRQQRLQAQV---LL
Q695T5_E1B19K-01        GYTLDFLTLCLWKFGIR---RGRKLYGRLVERHPSLRQQRLQAQV---LL
H9TER0_E1B19K-01        GYTLDFLTLCLWKFGIR---RGRKLYGRLVERHPSLRQQRLQAQV---LL
A0A0G2UY10_E1B19K-      GYILDFAAMHLWRSWIR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
X4Y9D2_E1B19K-01        GYILDFAAMHLWRSWIR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
C5HDR2_E1B19K-01        GYILDFAAMHLWRAWVR---QRGQRILNYWLIQP-AVPGLLRLHRQTSML
M0QVC7_E1B19K-01        GYILDFAAMHLWRAWVR---QRGQRILNYWLIQP-AAPGLLRLHRQTSML
A0A3S6PYX7_E1B19K-      GYILDFAAMHLWRAWVR---QRGQRILNYWLIQP-AAPGLLRLHRQTSML
Q4KSL0_E1B19K-01        GYILDFAAMHLWRAWIR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
A0A1P7YYY5_E1B19K-      GYILDFAAMHLWRAWMR---QRGQRILNYWLLQP-AASGLLHLHRQTSML
A0A1P8C849_E1B19K-      GYILDFAAMHLWRAWMR---QRGQRILNYWLLQP-AALGLLHLHRQTSML
B9A5L5_E1B19K-01        GYILDFAAMHLWRAWMR---QRGQRILNYWLLQP-AASGLLHLHRQTSML
T1UGY3_E1B19K-01        GYILDFAAMHLWRAWMR---QRGQRILNYWLLQP-AASGLLHLHRQTSML
A0A1P7YWR9_E1B19K-      GYILDFAAMHLWRAWMR---QRGQRILNYWLLQP-AASGLLHLHRQTSML
A0A1P7YWY2_E1B19K-      GYILDFAAMHLWRAWMR---QRGQRILNYWLLQP-AASGLLHLHRQTSML
A0A1P7YXN8_E1B19K-      GYILDFAAMHLWRAWMR---QRGQRILNYWLLQP-AASGLLHLHRQTSML
B9A5A7_E1B19K-01        GYILDFAAMHLWRAWMR---QRGQRILNYWLLQP-AASGLLHLHRQTSML
T1UG22_E1B19K-01        GYILDFAAMHLWRAWMR---QRGQRILNYWLLQP-AASGLLHLHRQTSML
H5T740_E1B19K-01        DYILDFTAMHLWKAWVR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
A0A1J0MS84_E1B19K-      GYILDFAAMHLWRSWVR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
A0A097I4T0_E1B19K-      GYILDFAAMHLWRAWVR---QRGQRILNYWLIQP-AAPGLLRLHRQTSML
E5RWD9_E1B19K-01        GYILDFAAMHLWRAWVR---QRGQRILNYWLIQP-AAPGLLRLHRQTSML
M0QU76_E1B19K-01        GYILDFAAMHLWRAWVR---QRGQRILNYWLIQP-AAPGLLRLHRQTSML
B9A5T7_E1B19K-01        GYILDFAAMHLWRAWVR---QRGQRILNYWLIQP-AAPGLLRLHRQTSML
D3GBW3_E1B19K-01        GYILDFAAMHLWRAWVR---QRGQRILNYWLIQP-AVPGLLRLHRQTSML
M0QUF3_E1B19K-01        GYILDFAAMHLWRAWVR---QRGQRILNYWLIQP-AAPGLLRLHRQTSML
E5RWL1_E1B19K-01        GYILDFAAMHLWRAWVR---QRGQRILNYWLIQP-AAPGLLRLHRQTSML
B6C6W8_E1B19K-01        GYILDFAAMHLWRAWVR---QRGQRILNYWLIQP-AAPGLLRLHRQTSML
M0QU41_E1B19K-01        GYILDFAAMHLWRAWVR---QRGQRILNYWLIQP-AAPGLLRLHRQTSML
F1DT57_E1B19K-01        GYILDFAAMHLWRAWVR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
B2VQE3_E1B19K-01        GYILDFAAMHLWRAWVR---QRGQRILNYWLIQP-AAPGLLRLHRQTSML
B9A681_E1B19K-01        GYILDFAAMHLWRAWVR---QRGQRILNYWLIQP-AAPGLLRLHRQTSML
A0A1Y1BYF1_E1B19K-      GYILDFAAMHLWRAWVR---QRGQRILNYWLIQP-AAPGLLRLHRQTSML
B6DU90_E1B19K-01        GYILDFAAMHLWRAWVR---QRGQRILNYWLIQP-AAPGLLRLHRQTSML
T1UHZ2_E1B19K-01        GYILDFAAMHLWRAWVR---QRGQRILNYWLIQP-AAPGLLRLHRQTSML
A0A3Q9FFS0_E1B19K-      GYILDFAAMHLWRAWVR---QRGQRILNYWLIQP-AAPGLLRLHRQTSML
T1ULJ8_E1B19K-01        GYILDFAAMHLWRAWIR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
T1UHG3_E1B19K-01        GYILDFAAMHLWRAWIR---QRGQRILNYWLLQP-AAPGLLCLHRQTSML
E9P585_E1B19K-01        GYILDFAAMHLWRAWIR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
A0A1Y1BXT7_E1B19K-      GYILDFAAMHLWRAWIR---QRGQKILNYWLLQP-AAPGLLRLHRQTSML
T1UHL7_E1B19K-01        GYILDFAAMHLWRSWIR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
A0A075TSZ1_E1B19K-      GYILDFAAMHLWRSWIR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
T1UHH6_E1B19K-01        GYILDFAAMHLWRSWIR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
T1UKP8_E1B19K-01        GYILDFAAMHLWRSWIR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
B9A5Q1_E1B19K-01        GYILDFAAMHLWRAWIR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
M0QUB4_E1B19K-01        GYILDFAAMHLWRAWIR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
M0QUJ3_E1B19K-01        GYILDFAAMHLWRAWIR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
M0QUN2_E1B19K-01        GYILDFAAMHLWRAWIR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
C4P207_E1B19K-01        GYILDFAAMHLWRAWIR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
E1CIM6_E1B19K-01        GYILDFAAMHLWRAWIR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
D4N3H6_E1B19K-01        GYILDFAAMHLWRAWIR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
M0QVK6_E1B19K-01        GYILDFAAMHLWRAWIR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
M0QVT4_E1B19K-01        GYILDFAAMHLWRAWIR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
E1AI10_E1B19K-01        GYILDFAAMHLWRAWIR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
H0PPE7_E1B19K-01        GYILDFAAMHLWRAWIR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
A0A3G8WIY5_E1B19K-      GYILDFAAMHLWRAWIR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
Q9YL99_E1B19K-01        GYILDFAAMHLWRAWIR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
K7ZLN6_E1B19K-01        GYILDFAAMHLWRAWIR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
A0A384ZUF2_E1B19K-      GYILDFAAMHLWRAWIR---QRGQRILNYWLLQP-AAPVLLRLHRQTSML
A0A384ZUM9_E1B19K-      GYILDFAAMHLWRAWIR---QRGQRILSYWLLQP-AAPGLLRLHRQTSML
E1CIR1_E1B19K-01        GYILDFAAMHLWRAWIR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
T1UHQ8_E1B19K-01        GYILDFAAMHLWRAWIR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
T1ULP4_E1B19K-01        GYILDFAAMHLWRAWIR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
A0A291B0H2_E1B19K-      GYILDFAAMHLWRAWIR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
W8VNG2_E1B19K-01        GYILDFAAMHLWRAWIR---QRGQRILNYWLLQP-AAPGLLHLHRQTSML
F8UFP5_E1B19K-01        GYILDFAAMHLWRAWIR---QRGQRILNYWLLQP-AAPGLLHLHRQTSML
M0QV87_E1B19K-01        GYILDFAAMHLWRAWIR---QRGQRILNYWLLQP-AVPGLLRLHRQTSML
M0QU02_E1B19K-01        GYILDFAAMHLWRAWIR---QRGQRILNYWLLQP-AAPGLLHLHRQTSML
T1UKV6_E1B19K-01        GYILDFAAMHLWRAWIR---QRGQRILNYWLLQP-AVPGLLRLHRQTSML
M0QV47_E1B19K-01        DYILDFTAMHLWKAWVR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
M0QUW8_E1B19K-01        DYILDFTAMHLWKAWVR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
E1CIJ0_E1B19K-01        DYILDFTAMHLWKAWVR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
T1UGU0_E1B19K-01        DYILDFTAMHLWKAWVR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
M0QVG6_E1B19K-01        DYILDFTAMHLWKAWVR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
X4YVU5_E1B19K-01        DYILDFTAMHLWKAWVR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
M0QUS9_E1B19K-01        GYILDFTAMHLWRAWVR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
G1FBW4_E1B19K-01        DYILDFTAMHLWKAWVR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
M0QVP5_E1B19K-01        DYILDFTAMHLWKAWVR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
T1UKQ0_E1B19K-01        DYILDFTAMHLWKAWVR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
W8CZB0_E1B19K-01        GYILDFAAMHLWRAWVR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
G1FC01_E1B19K-01        GYILDFAAMHLWRAWVR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
G3CK71_E1B19K-01        GYILDFAAMHLWRAWVR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
T1UGT5_E1B19K-01        GYILDFAAMHLWRAWVR---QRGQRILNYWLLQP-AVPGLLRLHRQTSML
T1UK99_E1B19K-01        DYILDFTAMHLWKAWVR---QRGQRILNYWLLQP-AAPGLLHLHRQTSML
M0QTS5_E1B19K-01        GYILDFAAMHLWRAWVR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
M0QV08_E1B19K-01        GYILDFAAMHLWRAWVR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
G9JUV5_E1B19K-01        GYILDFAAMHLWRAWVR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
T1UGX3_E1B19K-01        GYILDFAAMHLWRAWVR---QRGQRILNYWLLQP-AAPGLLRLHRQTSML
Q7T951_E1B19K-01        GYVLDFIATALWRTWKV---RKMRTILGYWPVQPLGVAGILRHPPVMPAV
T1UE63_E1B19K-01        GYVLDFIATALWRTWKV---RKMRTILGYWPVQPLGVAGILRHPPVMPAV
Q7T8D8_E1B19K-01        GYVLDFIATALWRTWKV---RKMRTILGYWPVQPLGVAGILRHPPVMPAV
Q8B8U7_E1B19K-01        GYVLDFIATALWRTWKV---RKMRTILGYWPVQPLGVAGILRHPPVMPAV
Q5UW22_E1B19K-01        GYVLDFIATALWRTWKV---RKMRTILGYWPVQPLGVAGILRHPPVMPAV
W6EIX6_E1B19K-01        GYVLDFIATALWRTWKV---RKMRTILGYWPVQPLGVAGILRHPPVMPAV
Q3ZL02_E1B19K-01        GYVLDFVATALWRTWKV---RKMRTILGYWPVQPLGVAGILRHPPVMPAV
A0A1L7NRH1_E1B19K-      GYVLDFIATALWRTWKV---RKMRTILGYWPVQPLGVAGILRHPPVMPAV
T1UFS4_E1B19K-01        GYVLDFVATALWRTWKV---RKMRTILGYWPVQPLGVAGILRHPPVMPAV
Q32UI6_E1B19K-01        GYVLDFVATALWRTWKV---RKMRTILGYWPVQPLGVAGILRHPPVMPAV
C7SRS7_E1B19K-01        GYVLDFVATALWRTWKV---RKMRTILGYWPVQPLGVAGILRHPPVMPAV
J7H4R9_E1B19K-01        GYVLDFVATALWRTWKV---RKMRTILGYWPVQPLGVAGILRHPPVMPAV
D2DM83_E1B19K-01        GYVLDFVATALWRTWKV---RKMRTILGYWPVQPLGVAGILRHPPVMPAV
J7I6W7_E1B19K-01        GYVLDFVATALWRTWKV---RKMRTILGYWPVQPLGVAGILRHPPVMPAV
T1UJX4_E1B19K-01        GYVLDFIATALWRTWKV---RKMRTILGYWPVQPLGVAGILRHPPVMPAV
T2CI10_E1B19K-01        GYVLDFIAAALWRTWKA---RRMRTILDYWPVQPLGVAGILRHPPTMPAV
A0A0K0PX99_E1B19K-      GYVLDFIAAALWRTWKA---RRMRTILDYWPVQPLGVAGILRHPPAMPAV
A0A0K0PX35_E1B19K-      GYVLDFIAAALWRTWKA---RRMRTILDYWPVQPLGVAGILRHPPAMPSV
A0A220VZ73_E1B19K-      GYVLDFIAAALWRTWKA---RRMRTILNYWPVQPLGVAGILRHPPTMPAV
R4HLE1_E1B19K-01        GYVLDFIAAALWRTWKA---RRMRTILDYWPVQPLGVAGILRHPPTMPAV
R4HMC6_E1B19K-01        GYVLDFIAAALWRTWKA---RRMRTILNYWPVQPLGVAGILRHPPTMPAV
I1V161_E1B19K-01        GYVLDFIAAALWRTWKA---RRMRTILNYWPVQPLGVAGILRHPPTMPAV
P03248_E1B19K-02        GYVLDFIAAALWRTWKA---RRMRTILDYWPVQPLGVAGILRHPPTMPAV
Q6RK98_E1B19K-01        GYVLDFIAAALWRTWKA---RRMRTILDYWPVQPLGVAGILRHPPTMPAV
J7I6Q4_E1B19K-01        GYVLDFIAAALWRTWKA---RRMRTILDYWPVQPLGVAGILRHPPTMPAV
J7I6S4_E1B19K-01        GYVLDFIAAALWRTWKA---RRMRTILNYWPVQPLGVAGILRHPPTMPAV
R4HLJ6_E1B19K-01        GYVLDFIAAALWRTWKA---RRMRTILDYWPVQPLGVAGILRHPPTMPAV
R4HLA0_E1B19K-01        GYVLDFIAAALWRTWKA---RRMRTILDYWPVQPLGVAGILRHPPTMPAV
Q2KSL3_E1B19K-01        GYVLDFIAAALWRTWKA---RRMRTILDYWPVQPLGVAGILRHPPTMPAV
Q2Y0J3_E1B19K-01        GYVLDFIAAALWRTWKA---RRMRTILDYWPVQPLGVAGILRHPPTMPAV
Q5EY83_E1B19K-01        GYVLDFIAAALWRTWKA---RRMRTILDYWPVQPLGVAGILRHPPTMPAV
I6LEP5_E1B19K-01        GYVLDFIAAALWRTWKA---RRMRTILDYWPVQPLGVAGILRHPPTMPAV
I6LES1_E1B19K-01        GYVLDFIAAALWRTWKA---RRMRTILDYWPVQPLGVAGILRHPPTMPAV
T1UF50_E1B19K-01        GYVLDFIAAALWRTWKA---RRMRTILDYWPVQPLGVAGILRHPPTMPAV
J7ID56_E1B19K-01        GYVLDFIAAALWRTWKA---RRMRTILDYWPVQPLGVAGILRHPPTMPAV
A0A0B4SJH1_E1B19K-      GYVLDFIAAALWRTWKA---RRMRTILDYWPVQPLGVAGILRHPPAMPAV
A0A075IQ70_E1B19K-      GYVLDFIAAALWRTWKA---RRMRTILDYWPVQPLGVAGILRHPPAMPAV
Q2KS85_E1B19K-01        GYVLDFIAAALWRTWKA---RRMRTILDYWPVQPLGVAGILRHPPAMPAV
Q3ZKW2_E1B19K-01        GYVLDFIAAALWRTWKA---RSMRTILDYWPVQPLGVAGILRHPPTMPAV
K7NG43_E1B19K-01        GYVLDFIAAALWRTWKA---RRMRTILDYWPVQPLGVAGILRHPPAMPAV
Q2KRU2_E1B19K-01        GYVLDFIAAALWRTWKA---RRMRTILDYWPVQPLGVAGILRHPPAMPAV
T1UIP3_E1B19K-01        GYVLDFIAAALWRTWKA---RRMRTILDYWPVQPLGVAGILRHPPAMPAV
Q6QPF3_E1B19K-01        DYRLDCLAVALWRTWRC---QRLNAISGYLPVQPVDTLRILSLQSPQEHQ
Q6QPB7_E1B19K-01        DYRLDCLAVALWRTWRC---QRLNAISGYLPVQPVDTLRILSLQSPQEHQ
Q6QPI9_E1B19K-01        DYRLDCLAVALWRTWRC---QRLNAISGYLPVQPVDTLRILSLQSPQEHQ
P10406_E1B19K-01        DYQLDFLAVALWRTWKC---QRLNAIPATCRYSR----------------
Q5GFC7_E1B19K-01        DYQLDFLAVALWRTWKC---QRLNAIPATCRYSR----------------
A0A2R3WN62_E1B19K-      DYQLDFLAVALWRTWKC---QRLNAIPATCRYSR----------------
A0A3G9JTX5_E1B19K-      DYQLDFLAVALWRAWKC---QRLNAIPATCRYSR----------------
Q2KSM8_E1B19K-02        DYQLDFLAVALWRAWKC---QRLNAIPATCRYSR----------------
A0A2R3WNP3_E1B19K-      DYQLDFLAVALWRAWKC---QRLNAIPATCRYSR----------------
Q2KSG6_E1B19K-02        DYQLDFLAVALWRAWKC---QRLNAI---CRYSR----------------
A0A2L1F392_E1B19K-      DYQLDFLAVALWRAWKC---QRLNAI---CRYSR----------------
A0A3G9CMQ4_E1B19K-      DYQLDFLAVALWRTWKC---QRLNAISGYLPVQPLDTLRILSLQ------
Q5GFC8_E1B19K-01        DYQLDFLAVALWRTWKC---QRLNAISGYLPVQPLDTLRILSLQ------
Q6H1D7_E1B19K-01        DYQLDFLAVALWRTWKC---QRLNAISGYLPVQPLDTLRILSLQ------
A0A3G8W6L2_E1B19K-      DYQLDFLAVALWRAWKC---QRLNAISGYLPVQPLDTLRILSLQQISQER
Q2KSG6_E1B19K-01        DYQLDFLAVALWRAWKC---QRLNAISGYLPVQPLDTLRILSLQQISQER
Q2KSM8_E1B19K-01        DYQLDFLAVALWRAWKC---QRLNAISGYLPVQPLDTLRILSLQQISQER
A0A2R3WN16_E1B19K-      DYQLDFLAVALWRAWKC---QRLNAISGYLPVQPLDTLRILSLQQISQER
G9G841_E1B19K-01        DYQLDFLAVALWRTWKS---QRLNAISGYLPVQPLDTLKILNLQESPRAR
Q8UY91_E1B19K-01        DYQLDFLAVALWRTWKC---QRLNAISGYLPVQPLDTLRILNLQESPRAR
                                                                          

Q71BY5_E1B19K-01        --------------------------------------------------
A0A0M4NHE0_E1B19K-      SEESKPEVNPEAQGEAKEE----------------ALRSGLDPPVEED--
H9AAK5_E1B19K-01        SEESKPEVNPEAQGEAKEE----------------TLRSGLDPPVEEN--
G0ZAH2_E1B19K-01        LEERERERQQREREQQQQEGEMTTSIWRPSMEAEWPPRAGMDPPLEEQWE
A0A3Q9HK00_E1B19K-      QQQQQQQQQEEARRRRRQE------------QSPWNPRAGLDPRE-----
A0A3Q9HK78_E1B19K-      -QQQQQQQQEEARRRRRQE------------QSPWNPRAGLDPRE-----
A0A3S9SPV1_E1B19K-      QQQQQQQQQEEARRRRRQE------------QSPWNPRAGLDPRE-----
A0A1W5PVU4_E1B19K-      DQTRL---------LEAEE----------------EPRAGMDPPSET---
A0A0M3TH18_E1B19K-      DQTRL---------LEAEE----------------EPRAGTDPPSET---
A0A097IW62_E1B19K-      DRVCL---------LEA-E----------------NPRAGMDPPSEN---
A0A0A1EUE4_E1B19K-      --------------PDETE----------------NLRAGLDPPMED---
A0A2H5AI40_E1B19K-      --------------PEETE----------------NLRAGLDPPVED---
A0A2H5AID8_E1B19K-      --------------PEETE----------------NLRAGLDPPVED---
A0A2H5AII9_E1B19K-      --------------PEETE----------------NLRAGLDPPVED---
A0A2H5AIL0_E1B19K-      --------------PEETE----------------NLRAGLDPPVED---
A0A2H5AIN5_E1B19K-      --------------PEETE----------------NLRAGLDPPVED---
A0A2H5AIS9_E1B19K-      --------------PEETE----------------NLRAGLDPPVED---
A0A2H5AIT6_E1B19K-      --------------PEETE----------------NLRAGLDPPVED---
A0A2H5AIU0_E1B19K-      --------------PEETE----------------NLRAGLDPPVED---
A0A2H5AIC5_E1B19K-      --------------PEETE----------------NLRAGLDPPVED---
D3JIR7_E1B19K-01        --------------LEQRD----------------P------AAEK----
A0A076V686_E1B19K-      ---------------EERD----------------P------AVEK----
G1DE13_E1B19K-01        --------------QEEQQ----------------N------TTTEE---
D0Z5R9_E1B19K-01        --------------QEEQQ----------------N------TTTEE---
T1UEX7_E1B19K-01        --------------QEEQQ----------------N------TTTEE---
A0A3G8WH01_E1B19K-      --------------EEERN----------------P------AVVEK---
P04492_E1B19K-01        --------------EEERN----------------P------AVVEK---
A0A2H5AI99_E1B19K-      --------------PVETD----------------NPRAGLDPPVED---
A0A0M3TH31_E1B19K-      ----------------ENE----------------NPRAGVDPPLE----
M9YXY5_E1B19K-01        ----------------ENE----------------NPRAGVDPPLE----
M9YVF6_E1B19K-01        ------------------E----------------NPRAGVDPPLE----
A0MK43_E1B19K-01        --------------PEETE----------------NLRAGLDPPVED---
A0A2H5AI21_E1B19K-      --------------PEETE----------------NLRAGLDPPVED---
A0A0M5L3Y4_E1B19K-      --------------PEETE----------------NLRAGLDPPVED---
Q5C8R2_E1B19K-01        --------------PEETE----------------NLRAGLDPPVED---
A0A0A1EUB2_E1B19K-      --------------PGEME----------------NLRAGLDPPTED---
A0A0A1EUC8_E1B19K-      --------------PGETE----------------NLRAGLDPPTED---
A0A2H5AI04_E1B19K-      --------------PGETE----------------NLRAGLDPPTED---
A0A2H5AI72_E1B19K-      --------------PGETE----------------NLRAGLDPPTED---
A0A2H5AIL3_E1B19K-      --------------PGETE----------------NLRAGLDPPTED---
A0A2H4CJZ0_E1B19K-      --------------PEEEE----------------NPRAGLDPSAE----
H8PFZ1_E1B19K-01        --------------LEEEE----------------NPRAGLDPPAE----
A0A1S6ELT2_E1B19K-      --------------EEERE----------------NLRAGLDPQTEL---
A0A3G4W995_E1B19K-      --------------EEEEE----------------NLRAGLDPQTEL---
B5SNR1_E1B19K-01        --------------EEEEE----------------NLRAGLDPQTEL---
P10544_E1B19K-01        --------------EEEEE----------------NLRAGLDPQTEL---
W0S1G8_E1B19K-01        --------------EEEEE----------------NLRAGLDPQTEL---
A0A3G8W407_E1B19K-      --------------EEEEE----------------NLRAGLDPQTEL---
F4ZCJ8_E1B19K-01        --------------EEEEE----------------NLRAGLDPQTEL---
A0A142G3J2_E1B19K-      --------------EEEEE----------------NLRAGLDPSTEL---
P10543_E1B19K-01        --------------EEEEE----------------NLRAGLDPSTEL---
A0A3S9SNH4_E1B19K-      QQQQQEEARRRRRQEQSPW----------------NPRAGLDPR-E----
A0A3S9SSS2_E1B19K-      QQQQQEEARRRRRQEQSPW----------------NPRAGLDPR-E----
A0A3S9SNY0_E1B19K-      QQQQQEEARRRRRQEQSPW----------------NPRAGLDPR-E----
Q71BY5_E1B19K-02        QQQQQEEARRRRRQEQSPW----------------NPRAGLDPR-E----
A0A3Q9HJ63_E1B19K-      QQQQQEEARRRRRQEQSPW----------------NPRAGLDPR-E----
A0A3Q9HLF7_E1B19K-      QQQQQEEARRRRRQEQSPW----------------NPRAGLDPR-E----
E1ARN8_E1B19K-01        QQQQQEEARRRRRQEQSPW----------------NPRAGLDPR-E----
A0A2H4PJ75_E1B19K-      QQQQQEEARRRRRQEQSPW----------------NPRAGLDPR-E----
Q6WQ37_E1B19K-01        -QQQQQEEARRRRQEQSPW----------------NPRAGLDPR-E----
P03246_E1B19K-01        -QQQQQEEARRRRQEQSPW----------------NPRAGLDPR-E----
Q6VGV8_E1B19K-01        -QQQQQEEARRRRQEQSPW----------------NPRAGLDPR-E----
A0A0G2R248_E1B19K-      -QQQQQEEARRRRQEQSPW----------------NPRAGLDPR-E----
A0A3Q9HJ54_E1B19K-      -QQQEEARRRRRRQEQSPW----------------NPRAGLDPR-E----
A0A3S9SND6_E1B19K-      QQQQQEEARRRRRQEQSPW----------------NPRAGLDPR-E----
A0A3S9SP19_E1B19K-      --QQQEEARRRRRQEQSPW----------------NPRAGLDPR-E----
A0A291P1B2_E1B19K-      --QQQEEARRRRRQEQSPW----------------NPRAGLDPR-E----
T1UG63_E1B19K-01        QQQQEEARRRRRRQEQSPW----------------NPRAGLDPR-E----
A0A1U9ALK7_E1B19K-      --QQQEEARRRRRQEQSPW----------------NPRAGLDPR-E----
P03247_E1B19K-01        --QQQEEARRRRRQEQSPW----------------NPRAGLDPR-E----
A0A3G8W3H5_E1B19K-      --QQQEEARRRRRQEQSPW----------------NPRAGLDPR-E----
J9Z5H0_E1B19K-01        --QQQEEARRRRRQEQSPW----------------NPRAGLDPR-E----
J9Z4N4_E1B19K-01        QQQQQEEARRRRRQEQSPW----------------NPRAGLDPR-E----
A0A3Q9HJZ5_E1B19K-      QQQQQEEARRRRRQEQSPW----------------NPRAGLDPR-E----
J7I6T8_E1B19K-01        QQQQQEEARRRRRQEQSPW----------------NPRAGLDPR-E----
J9Z4H6_E1B19K-01        QQQQQEEARRRRRQEQSPW----------------NPRAGLDPR-E----
P06501_E1B19K-01        QQEE-QQQRQEEEQVQE------------------EMRSGLDPP-TEN--
A0A0M4N3Z1_E1B19K-      QQEEQQQQRQEEQQVQEEG----------------EMRSGLDPP-TEN--
Q8B6X5_E1B19K-01        QQEEQQQQRQEEQQVQEEG----------------EMRSGLDPP-TEN--
H9AAD9_E1B19K-01        ESKPEVNPEAQGEAKE--E----------------TLRSGLDPPVEEN--
H9AAH3_E1B19K-01        ESKPEVNPEAQGEAKE--E----------------TLRSGLNPPVEEN--
H9AAA8_E1B19K-01        EVKPEVAGQGEEQEQEQKP----------------ALRSGLDPP-EEN--
M9YVA3_E1B19K-01        EVKPEVAGQGEEQEQE--P----------------ALRSGLDPP-EEN--
F2WTJ7_E1B19K-01        EVKPKVAGQGEEQEQE--P----------------ALRSGLDPP-EEKED
F2WTM9_E1B19K-01        EVKPKVAGQGEEQEQE--P----------------ALRSGLDPP-EEKED
H9AA76_E1B19K-01        EVKPEVAGQGEEQEPE--P----------------ALRSGLDPP-EEN--
A0A1C8EG46_E1B19K-      EVKPEVAGQGEEQEQK--P----------------ALRSGLGPP-EEN--
H9AAN8_E1B19K-01        EVKPEVAGQGEEQEQE--P----------------ALRSGLDPP-EEN--
H9AAS0_E1B19K-01        EVKPEVAGQGEEQEQE--P----------------ALRSGLDPP-EEN--
H9AAV3_E1B19K-01        EVKPEVAGQGEEQEQE--P----------------ALRSGLDPP-EEN--
H9AAY5_E1B19K-01        EVKPEVAGQGEEQEQE--P----------------ALRSGLDPP-EEN--
A0A1L3INW0_E1B19K-      RWGALE--------NLAEE----------------DPRAGLDPP-EEEVD
F6KST6_E1B19K-01        RQEELETILEEEAMNMEEQ----------------NPRAGLDPP-VEA--
F2WTG5_E1B19K-01        RREDLEAISEEES-GMEE-----------------NPRAGLDPP-AEE--
Q695T5_E1B19K-01        RREDLEAISEEES-GMEEK----------------NPRAGLDPP-AEE--
H9TER0_E1B19K-01        RREDLEAISEEES-GMEEK----------------NPRAGLDPP-AEE--
A0A0G2UY10_E1B19K-      EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
X4Y9D2_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
C5HDR2_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
M0QVC7_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
A0A3S6PYX7_E1B19K-      EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
Q4KSL0_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
A0A1P7YYY5_E1B19K-      EEEIR---------EAMDK----------------NPRSGLDPPLEEELD
A0A1P8C849_E1B19K-      EEEMR---------EAMDK----------------NPRSGLDPPSEEELD
B9A5L5_E1B19K-01        EEEMR---------EAMDE----------------NPRSGLDPPSEEELD
T1UGY3_E1B19K-01        EEEMR---------EAMDE----------------NPRSGLDPPSEEELD
A0A1P7YWR9_E1B19K-      EEEMR---------EAMDK----------------NPRSGLDPPSEEELD
A0A1P7YWY2_E1B19K-      EEEMR---------ESMDK----------------NPRSGLDPPSEEELD
A0A1P7YXN8_E1B19K-      EEEMR---------EAMDK----------------NPRSGLDPPSEEELD
B9A5A7_E1B19K-01        EEEMR---------EAMDK----------------NPRSGLDPPSEEELD
T1UG22_E1B19K-01        EEEMR---------EAMDK----------------NPRSGLDPPSEEELD
H5T740_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
A0A1J0MS84_E1B19K-      EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
A0A097I4T0_E1B19K-      EEEMR---------QAMDE----------------NPRSGLDPPPEEELD
E5RWD9_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
M0QU76_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
B9A5T7_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELN
D3GBW3_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
M0QUF3_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
E5RWL1_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
B6C6W8_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELN
M0QU41_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
F1DT57_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
B2VQE3_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
B9A681_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELN
A0A1Y1BYF1_E1B19K-      EEEMR---------QAMDE----------------NPRSGLDPPSEEELN
B6DU90_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
T1UHZ2_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELN
A0A3Q9FFS0_E1B19K-      EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
T1ULJ8_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
T1UHG3_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
E9P585_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPLEEELD
A0A1Y1BXT7_E1B19K-      EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
T1UHL7_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
A0A075TSZ1_E1B19K-      EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
T1UHH6_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
T1UKP8_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
B9A5Q1_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
M0QUB4_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
M0QUJ3_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
M0QUN2_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
C4P207_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
E1CIM6_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
D4N3H6_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
M0QVK6_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
M0QVT4_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
E1AI10_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
H0PPE7_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
A0A3G8WIY5_E1B19K-      EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
Q9YL99_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
K7ZLN6_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
A0A384ZUF2_E1B19K-      EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
A0A384ZUM9_E1B19K-      EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
E1CIR1_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
T1UHQ8_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
T1ULP4_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
A0A291B0H2_E1B19K-      EEEMR---------EAMDE----------------NPRSGLDPPSEEELD
W8VNG2_E1B19K-01        EEEMR---------EAMDD----------------NPRSGLDPPSEEELD
F8UFP5_E1B19K-01        EEEMR---------EAMDD----------------NPRSGLDPPSEEELD
M0QV87_E1B19K-01        EEEMR---------EAMDE----------------NPRSGLDPPSEEELD
M0QU02_E1B19K-01        EEEMR---------EAMDE----------------NPRSGLDPPSEEELD
T1UKV6_E1B19K-01        EEEMR---------EAMDE----------------NPRSGLDPPSEEELD
M0QV47_E1B19K-01        EEEMR---------ETMDE----------------NPRSGLDPPSEEELD
M0QUW8_E1B19K-01        EEEMR---------EAMDE----------------NPRSGLDPPSEEELD
E1CIJ0_E1B19K-01        EEEMR---------EAMDE----------------NPRSGLDPPSEEELD
T1UGU0_E1B19K-01        EEEMR---------EAMDE----------------NPRSGLDPPSEEELD
M0QVG6_E1B19K-01        EEEMR---------EAMDE----------------NPRSGLDPPSEEELD
X4YVU5_E1B19K-01        EEEMR---------EAMDE----------------NPRSGLDPPSEEELD
M0QUS9_E1B19K-01        EEEMR---------EAMDE----------------NPRSGLDPPSEEELD
G1FBW4_E1B19K-01        EEEMR---------EAMDE----------------NPRSGLDPPSEEELD
M0QVP5_E1B19K-01        EEEMR---------EAMDE----------------NPRSGLDPPSEEELD
T1UKQ0_E1B19K-01        EEEMR---------EAMDE----------------NPRSGLDPPSEEELD
W8CZB0_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
G1FC01_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
G3CK71_E1B19K-01        EEEMR---------QAMYE----------------NPRSGLDPPSEEELD
T1UGT5_E1B19K-01        EEEMR---------EAMDE----------------NPRSGLDPPSEEELD
T1UK99_E1B19K-01        EEEMR---------EAMDE----------------NPRSGLDPPSEEELD
M0QTS5_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
M0QV08_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
G9JUV5_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
T1UGX3_E1B19K-01        EEEMR---------QAMDE----------------NPRSGLDPPSEEELD
Q7T951_E1B19K-01        LEE-----------EQQED----------------NPRAGLDPPVEEAE-
T1UE63_E1B19K-01        LEE-----------EQQED----------------NPRAGLDPPVEEAE-
Q7T8D8_E1B19K-01        LEE-----------EQQED----------------NPRAGLDPPVEEAE-
Q8B8U7_E1B19K-01        LEE-----------EQQED----------------NPRAGLDPPVEEAE-
Q5UW22_E1B19K-01        LEE-----------EQQED----------------NPRAGLDPPVEEAE-
W6EIX6_E1B19K-01        LEE-----------EQQED----------------NPRAGLDPPVEEAE-
Q3ZL02_E1B19K-01        LEE-----------EQQED----------------NPRAGLDPPVEEAE-
A0A1L7NRH1_E1B19K-      LEE-----------EQQED----------------NPRAGLDPPVEEAE-
T1UFS4_E1B19K-01        LEE-----------EQQED----------------NPRAGLDPPVEEAE-
Q32UI6_E1B19K-01        LEE-----------EQQED----------------NPRAGLDPPVEEAE-
C7SRS7_E1B19K-01        LEE-----------EQQED----------------NPRAGLDPPVEEAE-
J7H4R9_E1B19K-01        LEE-----------EQQED----------------NPRAGLDPPVEEAE-
D2DM83_E1B19K-01        LEE-----------EQQED----------------NPRAGLDPPVEEAE-
J7I6W7_E1B19K-01        LEE-----------EQQED----------------NPRAGLDPPVEEAE-
T1UJX4_E1B19K-01        LEE-----------EQQED----------------NPRAGLDPPVEEAE-
T2CI10_E1B19K-01        LEE-----------EHQED----------------NPRVGLDPPVEEAEE
A0A0K0PX99_E1B19K-      LEE-----------EQQED----------------NPRAGLDPPVEEAEE
A0A0K0PX35_E1B19K-      LEE-----------EQQED----------------NPRAGLDPPVEEAEE
A0A220VZ73_E1B19K-      LQE-----------EQQED----------------NPRAGLDPPVEE---
R4HLE1_E1B19K-01        LQE-----------EQQED----------------NPRAGLDPPVEE---
R4HMC6_E1B19K-01        LQE-----------EQQED----------------NPRAGLDPPVEE---
I1V161_E1B19K-01        LQE-----------EQQED----------------NPRAGLDPPVEE---
P03248_E1B19K-02        LQE-----------EQQED----------------NPRAGLDPPVEE---
Q6RK98_E1B19K-01        LQE-----------EQQED----------------NPRAGLDPPVEE---
J7I6Q4_E1B19K-01        LQE-----------EQQED----------------NPRAGLDPPVEE---
J7I6S4_E1B19K-01        LQE-----------EQQED----------------NPRAGLDPPVEE---
R4HLJ6_E1B19K-01        LQE-----------EQQED----------------NPRAGLDPPVEE---
R4HLA0_E1B19K-01        LQE-----------EQQED----------------NPRAGLDPPVEE---
Q2KSL3_E1B19K-01        LQE-----------EQQED----------------NPRAGLDPPVEE---
Q2Y0J3_E1B19K-01        LQE-----------EQQED----------------NPRAGLDPPVEE---
Q5EY83_E1B19K-01        LQE-----------EQQED----------------NPRAGLDPPVEE---
I6LEP5_E1B19K-01        LQE-----------EQQED----------------NPRAGLDPPVEE---
I6LES1_E1B19K-01        LQE-----------EQQED----------------NPRAGLDPPVEE---
T1UF50_E1B19K-01        LQE-----------EQQED----------------NPRAGLDPPVEE---
J7ID56_E1B19K-01        LQE-----------EQQED----------------NPRAGLDPPVEE---
A0A0B4SJH1_E1B19K-      LEE-----------EQQED----------------NPRAGLDPPVEE---
A0A075IQ70_E1B19K-      LEE-----------EQQED----------------NPRAGLDPPVEE---
Q2KS85_E1B19K-01        LEE-----------EQQED----------------NPRAGLDPPVEE---
Q3ZKW2_E1B19K-01        LEE-----------EQQED----------------NPRAGLDPPVEE---
K7NG43_E1B19K-01        LEE-----------EQQED----------------NPRAGLDPPVEE---
Q2KRU2_E1B19K-01        LEE-----------EQQED----------------NPRAGLDPPVEE---
T1UIP3_E1B19K-01        LEE-----------EQQED----------------NPRAGLDPPVEE---
Q6QPF3_E1B19K-01        RRQQPQQEQQQ--EEDREE----------------NPRAGLDPPVAEEEE
Q6QPB7_E1B19K-01        RRQQPQQEQQQEEEEDREE----------------NPRAGLDPPVAEEEE
Q6QPI9_E1B19K-01        RRQQPQQEQQQ--EEDREE----------------NLRAGLDPPVAEEEE
P10406_E1B19K-01        --------------------------------------------------
Q5GFC7_E1B19K-01        --------------------------------------------------
A0A2R3WN62_E1B19K-      --------------------------------------------------
A0A3G9JTX5_E1B19K-      --------------------------------------------------
Q2KSM8_E1B19K-02        --------------------------------------------------
A0A2R3WNP3_E1B19K-      --------------------------------------------------
Q2KSG6_E1B19K-02        --------------------------------------------------
A0A2L1F392_E1B19K-      --------------------------------------------------
A0A3G9CMQ4_E1B19K-      ---------QQ---EDQEE----------------NPRAGLDPPAEE---
Q5GFC8_E1B19K-01        ---------QQ---EDQEE----------------NPRAGLDPPAEE---
Q6H1D7_E1B19K-01        ---------QQ---EDQEE----------------NPRAGLDPPAEE---
A0A3G8W6L2_E1B19K-      QRR----QRQQ---EDQEE----------------NPRAGLDPPAEEEE-
Q2KSG6_E1B19K-01        QRR----QQQQ---EDQEE----------------NPRAGLDPPAEEE--
Q2KSM8_E1B19K-01        QRR----QQQQ---EDQEE----------------NPRAGLDPPAEEEE-
A0A2R3WN16_E1B19K-      QRR----QQQQ---EDQEE----------------NPRAGLDPPAEEEE-
G9G841_E1B19K-01        QRRRQQQRQQE---EDQEE----------------NPRAGLDPPAEEE--
Q8UY91_E1B19K-01        QRR--QQQQQE---EDQEE----------------NPRAGLDPPAEEEE-
                                                                          

Q71BY5_E1B19K-01        -------
A0A0M4NHE0_E1B19K-      -------
H9AAK5_E1B19K-01        -------
G0ZAH2_E1B19K-01        ADHDPEA
A0A3Q9HK00_E1B19K-      -------
A0A3Q9HK78_E1B19K-      -------
A0A3S9SPV1_E1B19K-      -------
A0A1W5PVU4_E1B19K-      -------
A0A0M3TH18_E1B19K-      -------
A0A097IW62_E1B19K-      -------
A0A0A1EUE4_E1B19K-      -------
A0A2H5AI40_E1B19K-      -------
A0A2H5AID8_E1B19K-      -------
A0A2H5AII9_E1B19K-      -------
A0A2H5AIL0_E1B19K-      -------
A0A2H5AIN5_E1B19K-      -------
A0A2H5AIS9_E1B19K-      -------
A0A2H5AIT6_E1B19K-      -------
A0A2H5AIU0_E1B19K-      -------
A0A2H5AIC5_E1B19K-      -------
D3JIR7_E1B19K-01        -------
A0A076V686_E1B19K-      -------
G1DE13_E1B19K-01        -------
D0Z5R9_E1B19K-01        -------
T1UEX7_E1B19K-01        -------
A0A3G8WH01_E1B19K-      -------
P04492_E1B19K-01        -------
A0A2H5AI99_E1B19K-      -------
A0A0M3TH31_E1B19K-      -------
M9YXY5_E1B19K-01        -------
M9YVF6_E1B19K-01        -------
A0MK43_E1B19K-01        -------
A0A2H5AI21_E1B19K-      -------
A0A0M5L3Y4_E1B19K-      -------
Q5C8R2_E1B19K-01        -------
A0A0A1EUB2_E1B19K-      -------
A0A0A1EUC8_E1B19K-      -------
A0A2H5AI04_E1B19K-      -------
A0A2H5AI72_E1B19K-      -------
A0A2H5AIL3_E1B19K-      -------
A0A2H4CJZ0_E1B19K-      -------
H8PFZ1_E1B19K-01        -------
A0A1S6ELT2_E1B19K-      -------
A0A3G4W995_E1B19K-      -------
B5SNR1_E1B19K-01        -------
P10544_E1B19K-01        -------
W0S1G8_E1B19K-01        -------
A0A3G8W407_E1B19K-      -------
F4ZCJ8_E1B19K-01        -------
A0A142G3J2_E1B19K-      -------
P10543_E1B19K-01        -------
A0A3S9SNH4_E1B19K-      -------
A0A3S9SSS2_E1B19K-      -------
A0A3S9SNY0_E1B19K-      -------
Q71BY5_E1B19K-02        -------
A0A3Q9HJ63_E1B19K-      -------
A0A3Q9HLF7_E1B19K-      -------
E1ARN8_E1B19K-01        -------
A0A2H4PJ75_E1B19K-      -------
Q6WQ37_E1B19K-01        -------
P03246_E1B19K-01        -------
Q6VGV8_E1B19K-01        -------
A0A0G2R248_E1B19K-      -------
A0A3Q9HJ54_E1B19K-      -------
A0A3S9SND6_E1B19K-      -------
A0A3S9SP19_E1B19K-      -------
A0A291P1B2_E1B19K-      -------
T1UG63_E1B19K-01        -------
A0A1U9ALK7_E1B19K-      -------
P03247_E1B19K-01        -------
A0A3G8W3H5_E1B19K-      -------
J9Z5H0_E1B19K-01        -------
J9Z4N4_E1B19K-01        -------
A0A3Q9HJZ5_E1B19K-      -------
J7I6T8_E1B19K-01        -------
J9Z4H6_E1B19K-01        -------
P06501_E1B19K-01        -------
A0A0M4N3Z1_E1B19K-      -------
Q8B6X5_E1B19K-01        -------
H9AAD9_E1B19K-01        -------
H9AAH3_E1B19K-01        -------
H9AAA8_E1B19K-01        -------
M9YVA3_E1B19K-01        -------
F2WTJ7_E1B19K-01        -------
F2WTM9_E1B19K-01        -------
H9AA76_E1B19K-01        -------
A0A1C8EG46_E1B19K-      -------
H9AAN8_E1B19K-01        -------
H9AAS0_E1B19K-01        -------
H9AAV3_E1B19K-01        -------
H9AAY5_E1B19K-01        -------
A0A1L3INW0_E1B19K-      -------
F6KST6_E1B19K-01        -------
F2WTG5_E1B19K-01        -------
Q695T5_E1B19K-01        -------
H9TER0_E1B19K-01        -------
A0A0G2UY10_E1B19K-      -------
X4Y9D2_E1B19K-01        -------
C5HDR2_E1B19K-01        -------
M0QVC7_E1B19K-01        -------
A0A3S6PYX7_E1B19K-      -------
Q4KSL0_E1B19K-01        -------
A0A1P7YYY5_E1B19K-      -------
A0A1P8C849_E1B19K-      -------
B9A5L5_E1B19K-01        -------
T1UGY3_E1B19K-01        -------
A0A1P7YWR9_E1B19K-      -------
A0A1P7YWY2_E1B19K-      -------
A0A1P7YXN8_E1B19K-      -------
B9A5A7_E1B19K-01        -------
T1UG22_E1B19K-01        -------
H5T740_E1B19K-01        -------
A0A1J0MS84_E1B19K-      -------
A0A097I4T0_E1B19K-      -------
E5RWD9_E1B19K-01        -------
M0QU76_E1B19K-01        -------
B9A5T7_E1B19K-01        -------
D3GBW3_E1B19K-01        -------
M0QUF3_E1B19K-01        -------
E5RWL1_E1B19K-01        -------
B6C6W8_E1B19K-01        -------
M0QU41_E1B19K-01        -------
F1DT57_E1B19K-01        -------
B2VQE3_E1B19K-01        -------
B9A681_E1B19K-01        -------
A0A1Y1BYF1_E1B19K-      -------
B6DU90_E1B19K-01        -------
T1UHZ2_E1B19K-01        -------
A0A3Q9FFS0_E1B19K-      -------
T1ULJ8_E1B19K-01        -------
T1UHG3_E1B19K-01        -------
E9P585_E1B19K-01        -------
A0A1Y1BXT7_E1B19K-      -------
T1UHL7_E1B19K-01        -------
A0A075TSZ1_E1B19K-      -------
T1UHH6_E1B19K-01        -------
T1UKP8_E1B19K-01        -------
B9A5Q1_E1B19K-01        -------
M0QUB4_E1B19K-01        -------
M0QUJ3_E1B19K-01        -------
M0QUN2_E1B19K-01        -------
C4P207_E1B19K-01        -------
E1CIM6_E1B19K-01        -------
D4N3H6_E1B19K-01        -------
M0QVK6_E1B19K-01        -------
M0QVT4_E1B19K-01        -------
E1AI10_E1B19K-01        -------
H0PPE7_E1B19K-01        -------
A0A3G8WIY5_E1B19K-      -------
Q9YL99_E1B19K-01        -------
K7ZLN6_E1B19K-01        -------
A0A384ZUF2_E1B19K-      -------
A0A384ZUM9_E1B19K-      -------
E1CIR1_E1B19K-01        -------
T1UHQ8_E1B19K-01        -------
T1ULP4_E1B19K-01        -------
A0A291B0H2_E1B19K-      -------
W8VNG2_E1B19K-01        -------
F8UFP5_E1B19K-01        -------
M0QV87_E1B19K-01        -------
M0QU02_E1B19K-01        -------
T1UKV6_E1B19K-01        -------
M0QV47_E1B19K-01        -------
M0QUW8_E1B19K-01        -------
E1CIJ0_E1B19K-01        -------
T1UGU0_E1B19K-01        -------
M0QVG6_E1B19K-01        -------
X4YVU5_E1B19K-01        -------
M0QUS9_E1B19K-01        -------
G1FBW4_E1B19K-01        -------
M0QVP5_E1B19K-01        -------
T1UKQ0_E1B19K-01        -------
W8CZB0_E1B19K-01        -------
G1FC01_E1B19K-01        -------
G3CK71_E1B19K-01        -------
T1UGT5_E1B19K-01        -------
T1UK99_E1B19K-01        -------
M0QTS5_E1B19K-01        -------
M0QV08_E1B19K-01        -------
G9JUV5_E1B19K-01        -------
T1UGX3_E1B19K-01        -------
Q7T951_E1B19K-01        -------
T1UE63_E1B19K-01        -------
Q7T8D8_E1B19K-01        -------
Q8B8U7_E1B19K-01        -------
Q5UW22_E1B19K-01        -------
W6EIX6_E1B19K-01        -------
Q3ZL02_E1B19K-01        -------
A0A1L7NRH1_E1B19K-      -------
T1UFS4_E1B19K-01        -------
Q32UI6_E1B19K-01        -------
C7SRS7_E1B19K-01        -------
J7H4R9_E1B19K-01        -------
D2DM83_E1B19K-01        -------
J7I6W7_E1B19K-01        -------
T1UJX4_E1B19K-01        -------
T2CI10_E1B19K-01        -------
A0A0K0PX99_E1B19K-      -------
A0A0K0PX35_E1B19K-      -------
A0A220VZ73_E1B19K-      -------
R4HLE1_E1B19K-01        -------
R4HMC6_E1B19K-01        -------
I1V161_E1B19K-01        -------
P03248_E1B19K-02        -------
Q6RK98_E1B19K-01        -------
J7I6Q4_E1B19K-01        -------
J7I6S4_E1B19K-01        -------
R4HLJ6_E1B19K-01        -------
R4HLA0_E1B19K-01        -------
Q2KSL3_E1B19K-01        -------
Q2Y0J3_E1B19K-01        -------
Q5EY83_E1B19K-01        -------
I6LEP5_E1B19K-01        -------
I6LES1_E1B19K-01        -------
T1UF50_E1B19K-01        -------
J7ID56_E1B19K-01        -------
A0A0B4SJH1_E1B19K-      -------
A0A075IQ70_E1B19K-      -------
Q2KS85_E1B19K-01        -------
Q3ZKW2_E1B19K-01        -------
K7NG43_E1B19K-01        -------
Q2KRU2_E1B19K-01        -------
T1UIP3_E1B19K-01        -------
Q6QPF3_E1B19K-01        -------
Q6QPB7_E1B19K-01        -------
Q6QPI9_E1B19K-01        -------
P10406_E1B19K-01        -------
Q5GFC7_E1B19K-01        -------
A0A2R3WN62_E1B19K-      -------
A0A3G9JTX5_E1B19K-      -------
Q2KSM8_E1B19K-02        -------
A0A2R3WNP3_E1B19K-      -------
Q2KSG6_E1B19K-02        -------
A0A2L1F392_E1B19K-      -------
A0A3G9CMQ4_E1B19K-      -------
Q5GFC8_E1B19K-01        -------
Q6H1D7_E1B19K-01        -------
A0A3G8W6L2_E1B19K-      -------
Q2KSG6_E1B19K-01        -------
Q2KSM8_E1B19K-01        -------
A0A2R3WN16_E1B19K-      -------
G9G841_E1B19K-01        -------
Q8UY91_E1B19K-01        -------
                               

© 1998-2019