Dataset for protein E1B 19K of organism Simian mastadenovirus C

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


M9YVF6_E1B19K-01      MDLLRLLSDYEVLRKLLETACEKNRSCWRFFFGSTLSNVVHRVKREHSEE
M9YXY5_E1B19K-01      MDLLRLLSDYEVLRKLLETACEKTSSCWRFFFGSTLSNVVHRVKREHSEE
                      ***********************. *************************

M9YVF6_E1B19K-01      FSRLVADVPGLFVSLDLGHHSYFQEKIVKGLVFESTGRTVVSVAFICFLL
M9YXY5_E1B19K-01      FSRLVADVPGLFVSLDLGHHSYFQEKIVKGLVFESTGRTVVSVAFICFLL
                      **************************************************

M9YVF6_E1B19K-01      DKWSSDSHLSWDYMLDYMTMALWRALLRRRRACIYLPVQPQQGLERVEEE
M9YXY5_E1B19K-01      DKWSSDSHLSWDYMLDYMTMALWRALLRRRRACIYLPVQPQRGLERVEEE
                      *****************************************.********

M9YVF6_E1B19K-01      EE--ENPRAGVDPPLE
M9YXY5_E1B19K-01      EEENENPRAGVDPPLE
                      **  ************

© 1998-2018