Dataset for protein E1B 19K of organism Simian adenovirus 13

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A0M3TH18_E1B19K-      -MKRPVAAEVQMELDRLLENYNSLRRVLEEASEDTSVWWRKLFGCRVSQL
A0A1W5PVU4_E1B19K-      MMKRPVAAEVQMELDRLLENYNSLRRVLEEASEDTSVWWRRLFGCRVSQL
                         ***************************************.*********

A0A0M3TH18_E1B19K-      VVQAKVEYKEEFEKLFSEVPGLVDSLNFCHHAFFYEKVICGLDFCTPGRT
A0A1W5PVU4_E1B19K-      VVQAKVEYKEEFEKLFSEVPGLVDSLNFCHHAFFYEKVICGLDFCTPGRT
                        **************************************************

A0A0M3TH18_E1B19K-      IAALAFCAFILDKWNKETHLSKGYTLDYISLQLWKAYMRKGKIYTFSQGP
A0A1W5PVU4_E1B19K-      IAALAFCAFILDKWNKETHLSRGYTLDYISLQLWKAYMRKGKIYTFSQGP
                        *********************.****************************

A0A0M3TH18_E1B19K-      RSLPQRVRRRLGFKTEDQTRLLEAEEEPRAGTDPPSET
A0A1W5PVU4_E1B19K-      RSLPQRVRRRLGFQTEDQTRLLEAEEEPRAGMDPPSET
                        *************:***************** ******

© 1998-2018