Dataset for protein adenoviridae of organism Human mastadenovirus E

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2L1F3A2_E1B19K-      MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQ
A0A2R3WN16_E1B19K-      MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQ
Q6H1D7_E1B19K-01        MEIWTVLEDFHKTRQLLENASNGVSYLWRFCFGGDLAKLVYRAKQDYREQ
A0A2L1F392_E1B19K-      MEIWTVLEDFYKTRQLLENASNGVSYLWRFCFGGDLAKLVYRTKQDYKEQ
A0A2R3WN62_E1B19K-      MEIWTVLEDFHKTRQLLENASNGVSYLWRFCFGGDLAKLVYRAKQDYREQ
                        **********:*******************************:****.**

A0A2L1F3A2_E1B19K-      FDDILKECPGLFDALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFVL
A0A2R3WN16_E1B19K-      FDDILKECPGLFDALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFVL
Q6H1D7_E1B19K-01        FEDILRECPGLFDALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFIF
A0A2L1F392_E1B19K-      FDDILKECPGLFDALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFVL
A0A2R3WN62_E1B19K-      FEDILRECPGLFDALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFIF
                        *:***.******************************************::

A0A2L1F3A2_E1B19K-      DKWSQETHFSRDYQLDFLAVALWRAWKCQRLNAI---SGYLPVQPLDTLR
A0A2R3WN16_E1B19K-      DKWSQETHFSRDYQLDFLAVALWRAWKCQRLNAI---SGYLPVQPLDTLR
Q6H1D7_E1B19K-01        DKWSQETHFSRDYQLDFLAVALWRTWKCQRLNAI---SGYLPVQPLDTLR
A0A2L1F392_E1B19K-      DKWSQETHFSRDYQLDFLAVALWRAWKCQRLNAI---CRYSR--------
A0A2R3WN62_E1B19K-      DKWSQETHFSRDYQLDFLAVALWRTWKCQRLNAIPATCRYSR--------
                        ************************:*********   . *          

A0A2L1F3A2_E1B19K-      ILSLQQISQERQRRQQQQEDQEENPRAGLDPPAEEE-
A0A2R3WN16_E1B19K-      ILSLQQISQERQRRQQQQEDQEENPRAGLDPPAEEEE
Q6H1D7_E1B19K-01        ILSL-----------QQQEDQEENPRAGLDPPAEE--
A0A2L1F392_E1B19K-      -------------------------------------
A0A2R3WN62_E1B19K-      -------------------------------------
                                                             

© 1998-2018