Dataset for protein adenoviridae of organism Human mastadenovirus D

[Download (right click)] [Edit] [Sequences] [Repertoires]

26 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A0G2UY10_E1B19K-      MTHGRGLVLYKWQHLGTWAQTFREFLMDVWTILADFSKTRRLVEDSSDGC
X4Y9D2_E1B19K-01        MTHGRGLVLYKWQHLGTRAQTFREFLMDVWTILADFSKTRRLVEDSSDGC
T1UG22_E1B19K-01        --------------------------MDVWSILGEFNKTRRLVEDSSDGC
T1UGY3_E1B19K-01        --------------------------MDVWSILGEFNKTRRLVEDSSDGC
T1UGU0_E1B19K-01        --------------------------MEVWTILADFNKTRRLVEDSSDGC
T1UKQ0_E1B19K-01        --------------------------MDVWTILADFNKTRRLVEDSSDGC
X4YVU5_E1B19K-01        --------------------------MEVWTILADFSKTRRLVEDSSDGC
F8UFP5_E1B19K-01        --------------------------MEVWTILADFNKTRRLVEDSSDGC
T1UKV6_E1B19K-01        --------------------------MDVWTILGDFNKTRRLVEDSSDGC
G3CK71_E1B19K-01        --------------------------MEVWTILGDFNKTRRLVEDSSDGC
T1UGT5_E1B19K-01        --------------------------MEVWTILADFNKTRRLVEDSSDGC
T1UK99_E1B19K-01        --------------------------MEVWTILGDFNKTRRLVEDSSDGC
T1ULJ8_E1B19K-01        --------------------------MDVWTILADFSKTRRLVEDSSDGC
T1UHG3_E1B19K-01        --------------------------MDVWTILADFSKTRRLVEDSSDGC
A0A291B0H2_E1B19K-      --------------------------MDVWTILGDFSKTRRLVEDSSDGC
E1CIR1_E1B19K-01        --------------------------MDVWTILADFSKTRRLVEDSSDGC
T1UHQ8_E1B19K-01        --------------------------MDVWTILADFSKTRRLVEDSSDGC
T1ULP4_E1B19K-01        --------------------------MDVWTILADFSKTRRLVEDSSDGC
A0A075TSZ1_E1B19K-      --------------------------MDVWTILADFSKTRRLVEDSSDGC
T1UHH6_E1B19K-01        --------------------------MDVWTILADFSKTRRLVEDSSDGC
T1UKP8_E1B19K-01        --------------------------MDVWTILADFSKTRRLVEDSSDGC
A0A1J0MS84_E1B19K-      --------------------------MDVWTILADFSKTRRLVEDSSDGC
T1UGX3_E1B19K-01        --------------------------MDVWTILADFSQTRRLVEDSSDGC
B6DU90_E1B19K-01        --------------------------MDVWTILADFSKTRRLVEDSSDGC
T1UHZ2_E1B19K-01        --------------------------MDVWTILADFSKTRRLVEDSSDGC
A0A097I4T0_E1B19K-      --------------------------MDVWTILADFSKTRRLVEDSSDGC
                                                  *:**:**.:*.:************

A0A0G2UY10_E1B19K-      SGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQ
X4Y9D2_E1B19K-01        SGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQ
T1UG22_E1B19K-01        SGFWRHWFGTPLSRLVYTVKKDYSEEFENLFADCSGLLDSLNFGHQSLFQ
T1UGY3_E1B19K-01        SGFWRHWFGTPLSRLVYTVKKDYSEEFENLFADCSGLLDSLNFGHQSLFQ
T1UGU0_E1B19K-01        SGFWRHWFGTPLARLVYTVKKDYQEEFENLFADCSGLLDSLNLGHQALFQ
T1UKQ0_E1B19K-01        SGFWRHWFGSPLSRLVYTVKKDYQEEFENLFADCSGLLDSLNLGHQALFQ
X4YVU5_E1B19K-01        SGFWRHWFGTPLSRLVYTVKKDYNEEFENLFVDCSGLLDSLNLGHQALFQ
F8UFP5_E1B19K-01        SGFWRHWFGTPLSRLVYTVKKDYSEEFENLFSDCSGLLDSLNFGHQSLFQ
T1UKV6_E1B19K-01        SGFWRHWFGTPLSRLVYTVKKDYSEEFENLFSDCSGLLDSLNFGHQSLFQ
G3CK71_E1B19K-01        SGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNFGHQSLFQ
T1UGT5_E1B19K-01        SGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNFGHQSLFQ
T1UK99_E1B19K-01        SGFWRHWFGTPLSRLVYTVKKDYQEEFENLFADCSGLLDSLNFGHQSLFQ
T1ULJ8_E1B19K-01        SGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSGLLDSLNLGHQALFQ
T1UHG3_E1B19K-01        SGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSGLLDSLNLGHQSLFQ
A0A291B0H2_E1B19K-      SGFWRHWFGTPLSRLVYTVKKDYSEEFENLFSDCSGLLDSLNLGHQSLFQ
E1CIR1_E1B19K-01        SGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSGLLDSLNLGHQSLFQ
T1UHQ8_E1B19K-01        SGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQ
T1ULP4_E1B19K-01        SGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSGLLDSLNLGHQSLFQ
A0A075TSZ1_E1B19K-      SGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSGLLDSLNLGHQSLFQ
T1UHH6_E1B19K-01        SGFWRHWFGTPLSRLVYTVKKDYKEEFENIFADCSGLLDSLNLGHQSLFQ
T1UKP8_E1B19K-01        SGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQ
A0A1J0MS84_E1B19K-      SGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQ
T1UGX3_E1B19K-01        SGFWRHWFGTPLSRLVYTVKKDYKEEFENLFADCSGLLDSLNFGHQSLFQ
B6DU90_E1B19K-01        SGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQ
T1UHZ2_E1B19K-01        SGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQ
A0A097I4T0_E1B19K-      SGFWRHWFGTPLSRLVYTVKKDYNEEFENLFADCSGLLDSLNLGHQSLFQ
                        *********:**:**********.*****:* **********:***:***

A0A0G2UY10_E1B19K-      ERVLHSLDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWR
X4Y9D2_E1B19K-01        ERVLHSLDFSSPGRTTAGVAFVVFLVDKWRQDTQLSRGYILDFAAMHLWR
T1UG22_E1B19K-01        ERVLHSLDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWR
T1UGY3_E1B19K-01        ERVLHSLDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWR
T1UGU0_E1B19K-01        ERVLHSLDFSSPGRTTAGVAFVVFLVDKWSQQTHLTRDYILDFTAMHLWK
T1UKQ0_E1B19K-01        ERVLHSLDFSSPGRTTAGVAFVVFLVDKWSQQTHLTRDYILDFTAMHLWK
X4YVU5_E1B19K-01        ERVLHSLDFSSPGRTTAGVAFVVFLVDKWSQQTHLTRDYILDFTAMHLWK
F8UFP5_E1B19K-01        ERVLHSLDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWR
T1UKV6_E1B19K-01        ERVLHSLDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWR
G3CK71_E1B19K-01        ERVLHSLDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWR
T1UGT5_E1B19K-01        ERVLHSLDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWR
T1UK99_E1B19K-01        ERVLHSLDFSSPGRTTAGVAFVVFLVDKWSQQTHLTRDYILDFTAMHLWK
T1ULJ8_E1B19K-01        ERVLHSLDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWR
T1UHG3_E1B19K-01        ERVLHSLDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWR
A0A291B0H2_E1B19K-      ERVLHSLDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWR
E1CIR1_E1B19K-01        ERVLHSLDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWR
T1UHQ8_E1B19K-01        ERVLHSLDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWR
T1ULP4_E1B19K-01        ERVLHSLDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWR
A0A075TSZ1_E1B19K-      ERVLHSLDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWR
T1UHH6_E1B19K-01        ERVLHSLDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWR
T1UKP8_E1B19K-01        ERVLHSLDFSSPGRTTAGVAFVVFLVDKWSQDTQLSRGYILDFAAMHLWR
A0A1J0MS84_E1B19K-      ERVLHSLDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWR
T1UGX3_E1B19K-01        ERVLHSLDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWR
B6DU90_E1B19K-01        ERVLHSLDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWR
T1UHZ2_E1B19K-01        ERVLHSLDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWR
A0A097I4T0_E1B19K-      ERVLHSLDFSSPGRTTAGVAFVVFLVDKWSQNTQLSRGYILDFAAMHLWR
                        ***************************** *:*:*:*.*****:*****.

A0A0G2UY10_E1B19K-      SWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEEMRQAMDENPRSGLD
X4Y9D2_E1B19K-01        SWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEEMRQAMDENPRSGLD
T1UG22_E1B19K-01        AWMRQRGQRILNYWLLQPAASGLLHLHRQTSMLEEEMREAMDKNPRSGLD
T1UGY3_E1B19K-01        AWMRQRGQRILNYWLLQPAASGLLHLHRQTSMLEEEMREAMDENPRSGLD
T1UGU0_E1B19K-01        AWVRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEEMREAMDENPRSGLD
T1UKQ0_E1B19K-01        AWVRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEEMREAMDENPRSGLD
X4YVU5_E1B19K-01        AWVRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEEMREAMDENPRSGLD
F8UFP5_E1B19K-01        AWIRQRGQRILNYWLLQPAAPGLLHLHRQTSMLEEEMREAMDDNPRSGLD
T1UKV6_E1B19K-01        AWIRQRGQRILNYWLLQPAVPGLLRLHRQTSMLEEEMREAMDENPRSGLD
G3CK71_E1B19K-01        AWVRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEEMRQAMYENPRSGLD
T1UGT5_E1B19K-01        AWVRQRGQRILNYWLLQPAVPGLLRLHRQTSMLEEEMREAMDENPRSGLD
T1UK99_E1B19K-01        AWVRQRGQRILNYWLLQPAAPGLLHLHRQTSMLEEEMREAMDENPRSGLD
T1ULJ8_E1B19K-01        AWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEEMRQAMDENPRSGLD
T1UHG3_E1B19K-01        AWIRQRGQRILNYWLLQPAAPGLLCLHRQTSMLEEEMRQAMDENPRSGLD
A0A291B0H2_E1B19K-      AWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEEMREAMDENPRSGLD
E1CIR1_E1B19K-01        AWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEEMRQAMDENPRSGLD
T1UHQ8_E1B19K-01        AWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEEMRQAMDENPRSGLD
T1ULP4_E1B19K-01        AWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEEMRQAMDENPRSGLD
A0A075TSZ1_E1B19K-      SWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEEMRQAMDENPRSGLD
T1UHH6_E1B19K-01        SWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEEMRQAMDENPRSGLD
T1UKP8_E1B19K-01        SWIRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEEMRQAMDENPRSGLD
A0A1J0MS84_E1B19K-      SWVRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEEMRQAMDENPRSGLD
T1UGX3_E1B19K-01        AWVRQRGQRILNYWLLQPAAPGLLRLHRQTSMLEEEMRQAMDENPRSGLD
B6DU90_E1B19K-01        AWVRQRGQRILNYWLIQPAAPGLLRLHRQTSMLEEEMRQAMDENPRSGLD
T1UHZ2_E1B19K-01        AWVRQRGQRILNYWLIQPAAPGLLRLHRQTSMLEEEMRQAMDENPRSGLD
A0A097I4T0_E1B19K-      AWVRQRGQRILNYWLIQPAAPGLLRLHRQTSMLEEEMRQAMDENPRSGLD
                        :*:************:***..*** *************:** .*******

A0A0G2UY10_E1B19K-      PPSEEELD
X4Y9D2_E1B19K-01        PPSEEELD
T1UG22_E1B19K-01        PPSEEELD
T1UGY3_E1B19K-01        PPSEEELD
T1UGU0_E1B19K-01        PPSEEELD
T1UKQ0_E1B19K-01        PPSEEELD
X4YVU5_E1B19K-01        PPSEEELD
F8UFP5_E1B19K-01        PPSEEELD
T1UKV6_E1B19K-01        PPSEEELD
G3CK71_E1B19K-01        PPSEEELD
T1UGT5_E1B19K-01        PPSEEELD
T1UK99_E1B19K-01        PPSEEELD
T1ULJ8_E1B19K-01        PPSEEELD
T1UHG3_E1B19K-01        PPSEEELD
A0A291B0H2_E1B19K-      PPSEEELD
E1CIR1_E1B19K-01        PPSEEELD
T1UHQ8_E1B19K-01        PPSEEELD
T1ULP4_E1B19K-01        PPSEEELD
A0A075TSZ1_E1B19K-      PPSEEELD
T1UHH6_E1B19K-01        PPSEEELD
T1UKP8_E1B19K-01        PPSEEELD
A0A1J0MS84_E1B19K-      PPSEEELD
T1UGX3_E1B19K-01        PPSEEELD
B6DU90_E1B19K-01        PPSEEELD
T1UHZ2_E1B19K-01        PPSEEELN
A0A097I4T0_E1B19K-      PPPEEELD
                        **.****:

© 1998-2018