Dataset for protein adenoviridae of organism Human mastadenovirus C

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A0G2R248_E1B19K-      MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWE
A0A2H4PJ75_E1B19K-      MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWE
E1ARN8_E1B19K-01        MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWE
A0A291P1B2_E1B19K-      METWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWE
J9Z5H0_E1B19K-01        MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWE
T1UG63_E1B19K-01        MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWE
J7I6T8_E1B19K-01        MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWE
J9Z4H6_E1B19K-01        MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWE
J9Z4N4_E1B19K-01        MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIKEDYKWE
                        **:***********************************************

A0A0G2R248_E1B19K-      FEELLKSCGELFDSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIK
A0A2H4PJ75_E1B19K-      FEELLKSCGELFDSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIK
E1ARN8_E1B19K-01        FEELLKSCGELFDSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIK
A0A291P1B2_E1B19K-      FEELLKSCGELFDSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIK
J9Z5H0_E1B19K-01        FEELLKSCGELFDSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIK
T1UG63_E1B19K-01        FEELLKSCGELFDSLNLGHQALFQEKVIKTLDFSTPGRTAAAVAFLSFIK
J7I6T8_E1B19K-01        FEELLKSCGELFDSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIK
J9Z4H6_E1B19K-01        FEELLKSCGELFDSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIK
J9Z4N4_E1B19K-01        FEELLKSCGELFDSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIK
                        **************************************:***********

A0A0G2R248_E1B19K-      DKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEE--
A0A2H4PJ75_E1B19K-      DKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEE--
E1ARN8_E1B19K-01        DKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEE-Q
A0A291P1B2_E1B19K-      DKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEE--
J9Z5H0_E1B19K-01        DKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEE--
T1UG63_E1B19K-01        DKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQ
J7I6T8_E1B19K-01        DKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEE--
J9Z4H6_E1B19K-01        DKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQ
J9Z4N4_E1B19K-01        DKWSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEE--
                        ************************************************  

A0A0G2R248_E1B19K-      ---QQQQQEEARRRRQEQSPWNPRAGLDPRE
A0A2H4PJ75_E1B19K-      -QQQQQQEEARRRRRQEQSPWNPRAGLDPRE
E1ARN8_E1B19K-01        QQQQQQQEEARRRRRQEQSPWNPRAGLDPRE
A0A291P1B2_E1B19K-      ----QQQEEARRRRRQEQSPWNPRAGLDPRE
J9Z5H0_E1B19K-01        ----QQQEEARRRRRQEQSPWNPRAGLDPRE
T1UG63_E1B19K-01        QQQQQQEEARRRRRRQEQSPWNPRAGLDPRE
J7I6T8_E1B19K-01        QQQQQQQEEARRRRRQEQSPWNPRAGLDPRE
J9Z4H6_E1B19K-01        QQQQQQQEEARRRRRQEQSPWNPRAGLDPRE
J9Z4N4_E1B19K-01        --QQQQQEEARRRRRQEQSPWNPRAGLDPRE
                            **::   ********************

© 1998-2018