Dataset for protein E1B 19K of organism Human mastadenovirus B

[Download (right click)] [Edit] [Sequences] [Repertoires]

16 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


T1UE63_E1B19K-01        MEVWAILEDLRKTRQLLESASDGVSGFWRFWFASELARVVFRIKQDYKQE
Q5UW22_E1B19K-01        MEVWAILEDLRKTRQLLENASDGVSGFWRFWFASELARVVFRIKQDYKQE
A0A1L7NRH1_E1B19K-      MEVWAILEDLRKTRQLLEDASDGVSGFWRFWFASELARVVFRIKQDYKEE
T1UFS4_E1B19K-01        MEVWAILEDLRKTRQLLEDASDGVSGFWRFWFASELARVVFRIKQDYKEE
J7I6W7_E1B19K-01        MEVWAILEDLRKTRQLLENASDGVSGFWRFWFASELARVVFRIKQDYKEE
T1UJX4_E1B19K-01        MEVWAILEDLRKTRQLLENASDGVSGFWRFWFASELARVVFRIKQDYKEE
T2CI10_E1B19K-01        MEVWAILEDLRQTRQLLENASDGVSGLWRFWFGGDLARLVFRIKQDYRQE
A0A0K0PX35_E1B19K-      MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREE
A0A0K0PX99_E1B19K-      MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREE
T1UIP3_E1B19K-01        MEVWAILEDLRQTRLLLENASDGVSGFWRFWFGGDLARLVFRIKQDYREE
J7ID56_E1B19K-01        MEVWAILEDLKQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREE
J7I6Q4_E1B19K-01        MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYSVE
J7I6S4_E1B19K-01        MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYSVE
I6LEP5_E1B19K-01        MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREE
I6LES1_E1B19K-01        MEVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREE
T1UF50_E1B19K-01        MKVWAILEDLRQTRLLLENASDGVSGLWRFWFGGDLARLVFRIKQDYREE
                        *:********.:** ***.*******:*****..:***:********  *

T1UE63_E1B19K-01        FEKLLVDCPGLFEALNLGHQVHFKEKVLSVLDFSTPGRTAAAVAFLTFIL
Q5UW22_E1B19K-01        FEKLLVDCPGLFEALNLGHQVHFKEKVLSVLDFSTPGRTAAAVAFLTFIL
A0A1L7NRH1_E1B19K-      FEKLLLDCPGLFEALNLGHQVHFKEKVLSVLDFSTPGRTAAAVAFLTFIL
T1UFS4_E1B19K-01        FEKLLVDCPGLFEALNLGHQVHFKEKVLSVLDFSTPGRTAAAVAFLTFIL
J7I6W7_E1B19K-01        FEKLLVDCPGLFEALNLGHQVHFKEKVLSVLDFSTPGRTAAAVAFLTFIL
T1UJX4_E1B19K-01        FEKLLVDCPGLFEALNLGHQVHFKEKVLSVLDFSTPGRTAAAVAFLTFIL
T2CI10_E1B19K-01        FEKLLDDCPGLFEALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFIF
A0A0K0PX35_E1B19K-      FEKLLDDSPGLFEALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFIL
A0A0K0PX99_E1B19K-      FEKLLDDSPGLFEALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFIL
T1UIP3_E1B19K-01        FEKLLDDSPGLFEALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFIL
J7ID56_E1B19K-01        FEKLLDDSPGLFEALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFIL
J7I6Q4_E1B19K-01        FEKLLDDSPGLFEALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFIL
J7I6S4_E1B19K-01        FEKLLDDSPGLFEALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFIL
I6LEP5_E1B19K-01        FEKLLDDSPGLFEALNLGHRAHFKEKVLSVLDFSTPGRTAAAVAFLTFIL
I6LES1_E1B19K-01        FEKLLDDSPGLFEALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFIL
T1UF50_E1B19K-01        FEKLLDDSPGLFEALNLGHQAHFKEKVLSVLDFSTPGRTAAAVAFLTFIL
                        ***** *.***********..****************************:

T1UE63_E1B19K-01        DKWIPQTHFSRGYVLDFIATALWRTWKVRKMRTILGYWPVQPLGVAGILR
Q5UW22_E1B19K-01        DKWIPQTHFSRGYVLDFIATALWRTWKVRKMRTILGYWPVQPLGVAGILR
A0A1L7NRH1_E1B19K-      DKWIPQTHFSRGYVLDFIATALWRTWKVRKMRTILGYWPVQPLGVAGILR
T1UFS4_E1B19K-01        DKWIPQTHFSRGYVLDFVATALWRTWKVRKMRTILGYWPVQPLGVAGILR
J7I6W7_E1B19K-01        DKWIPQTHFSRGYVLDFVATALWRTWKVRKMRTILGYWPVQPLGVAGILR
T1UJX4_E1B19K-01        DKWIPQTHFSRGYVLDFIATALWRTWKVRKMRTILGYWPVQPLGVAGILR
T2CI10_E1B19K-01        DKWIPQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILR
A0A0K0PX35_E1B19K-      DKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILR
A0A0K0PX99_E1B19K-      DKWIRQTHFSRGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILR
T1UIP3_E1B19K-01        DKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILR
J7ID56_E1B19K-01        DKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILR
J7I6Q4_E1B19K-01        DKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILR
J7I6S4_E1B19K-01        DKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILNYWPVQPLGVAGILR
I6LEP5_E1B19K-01        DKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILR
I6LES1_E1B19K-01        DKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILR
T1UF50_E1B19K-01        DKWIRQTHFSKGYVLDFIAAALWRTWKARRMRTILDYWPVQPLGVAGILR
                        **** *****.******:*:*******.*.*****.**************

T1UE63_E1B19K-01        HPPVMPAVLEEEQQEDNPRAGLDPPVEEAE-
Q5UW22_E1B19K-01        HPPVMPAVLEEEQQEDNPRAGLDPPVEEAE-
A0A1L7NRH1_E1B19K-      HPPVMPAVLEEEQQEDNPRAGLDPPVEEAE-
T1UFS4_E1B19K-01        HPPVMPAVLEEEQQEDNPRAGLDPPVEEAE-
J7I6W7_E1B19K-01        HPPVMPAVLEEEQQEDNPRAGLDPPVEEAE-
T1UJX4_E1B19K-01        HPPVMPAVLEEEQQEDNPRAGLDPPVEEAE-
T2CI10_E1B19K-01        HPPTMPAVLEEEHQEDNPRVGLDPPVEEAEE
A0A0K0PX35_E1B19K-      HPPAMPSVLEEEQQEDNPRAGLDPPVEEAEE
A0A0K0PX99_E1B19K-      HPPAMPAVLEEEQQEDNPRAGLDPPVEEAEE
T1UIP3_E1B19K-01        HPPAMPAVLEEEQQEDNPRAGLDPPVEE---
J7ID56_E1B19K-01        HPPTMPAVLQEEQQEDNPRAGLDPPVEE---
J7I6Q4_E1B19K-01        HPPTMPAVLQEEQQEDNPRAGLDPPVEE---
J7I6S4_E1B19K-01        HPPTMPAVLQEEQQEDNPRAGLDPPVEE---
I6LEP5_E1B19K-01        HPPTMPAVLQEEQQEDNPRAGLDPPVEE---
I6LES1_E1B19K-01        HPPTMPAVLQEEQQEDNPRAGLDPPVEE---
T1UF50_E1B19K-01        HPPTMPAVLQEEQQEDNPRAGLDPPVEE---
                        ***.**:**:**:******.********   

© 1998-2018